Identifiers and Description

Gene Model Identifier

Contig637.1.g135

Standard Name

MEX1a

Aliases

Contig637_1_g135

Description

Zinc finger C-x8-C-x5-C-x3-H type (and similar)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000743000.00000000000009996062864481225hypothetical protein
SGDYLR136C0.0000020007268868677913TIS11 SGDID:S000004126, Chr XI
I from 416658-415801, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig637.1.g135(coding)
ATGGAAGGACAACAACCACAACAACAAGATCAAAATCAGCAACAACCTCAATTCCAAATG
GGAGCTGACCCCAACCAATTCCCACAACAGTACATGATGGGAGGTGGATTTATGGGCTAA
GTCGATCCAAACATGATGATGCAAATGCAAGGATTCCCACAACAACAATACGGTGGCTAC
TAACAACCAATGGGTGGTCAACAATTCATGGGAGGCTACGGAATGGGTGGCGGCTACGGT
TAACAAATGGGAGGCAACAGTGCTTACGGCAGCAAATCTCACTTCCAAAGAGCTCAAGGA
AACGATCCAGCCAAGTACAAGACTGTCATGTGCAGACACTTCCAAACACAAGGTCAGTGC
ACCCTTGGAGACAAGTGCTCATTCGCTCACGGAGAACACGAACTCAGAAAGGGAGCTGGT
GGTCAAGTCTATCAACCAAAGCAATATGGAAGCGATAACAACGGTGGTGGTCGTGGAGGC
TACGTCCCAAGAGGAGGTCGCGGAGGCAGAGGTGGCTTCTAAAACTTCAACACTCAAGGC
CGTGATTAAACCTTCAAAACTGCTCTTTGCAAGAACTTCGAGCAAGGAAACTGCAAATAC
GGAGACAAGTGTTCATTCGCTCATGGAGATCACGAATTAAAGAAGGGTGGTAGCCCATCA
GGCCCAGGCAAATTCAACCTTAACCCACCACCAGTACCAGGTCTTGCTGGTTTCCAAGGT
ATTGGAGGTATGCCACCTGCTATGGGAGGTCTTCCAGTATACGGTCAACAACAATACGGA
ATGCAACAAATGCAACCACAACTTCAATAAAATCCACTCGTCGGAGGCGCTCAAGTTCAA
GCCAACGTTACCGGAGATTACCCATCCCTCGGAAACCCCAACTCACAATGA


>Contig637.1.g135(protein)
MEGQQPQQQDQNQQQPQFQMGADPNQFPQQYMMGGGFMGQVDPNMMMQMQGFPQQQYGGY
QQPMGGQQFMGGYGMGGGYGQQMGGNSAYGSKSHFQRAQGNDPAKYKTVMCRHFQTQGQC
TLGDKCSFAHGEHELRKGAGGQVYQPKQYGSDNNGGGRGGYVPRGGRGGRGGFQNFNTQG
RDQTFKTALCKNFEQGNCKYGDKCSFAHGDHELKKGGSPSGPGKFNLNPPPVPGLAGFQG
IGGMPPAMGGLPVYGQQQYGMQQMQPQLQQNPLVGGAQVQANVTGDYPSLGNPNSQ