Identifiers and Description

Gene Model Identifier

Contig18370.0.g85

Standard Name

METTL5

Aliases

Contig18370_0_g85

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007276603.0013534825799953e-36hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18370.0.g85(coding)
ATGTAAAGTGGCAAGGCTTTCAAGCTGAAAAGTTTCGTGTCTTACTTGTCTAACGTAGAA
GAGTTTGACAAACCAAATATCTAACTTGAACAGTATATGACACCACCAGATATCACAGCA
AATCTCTTTCAAATCCTCCATTTTGAGGAGGATGCTTTAGAAAATAAAATAGTTGGAGAT
TTTTGTTGTGGCACTGGGATGTATTCTATAGCTTCATCATATTTTAACACTTAAAAAGTG
ATAGGCTTTGACGTAGACCCAAACGCTCTAGCAATTTGTTAGGAAAACATAGATAATGCT
GAGCTTTCTGATAAAATAGAGATACTTAATTACGATCTTCTGAATATCCAAAATGAAGAG
AAATACAAAGACTATTTTGACACTGTTGTCATGAACCCACCTTTTGGCACAAAAAATAAT
GAGGGAATTGATATGAAATTACTAAGTGCTGCTATTTATGCAAGCAAAGGGAAAGTGTTC
TCATTGCACAAAGAATCAACATCAAAATATATCTTGAAATATGTTAAGGAAAATTACCCT
CAAGTGGAAGTTGAATTAATGCAAAAAATTGCTTTTGACTTGCCTAACACCTATAAGTTT
CACAAAAAAAAAAACGCTGTAACAGAAGTTGTGCTTGTGAAGATTGATAAGACTAAGTTA
AAAAAGCAGGAAGATAATGTTAATGAAATAAAGGAGCAATTAGTTGATTTGAAACTTTAA
GACACTTAAGACTAATGA


>Contig18370.0.g85(protein)
MQSGKAFKLKSFVSYLSNVEEFDKPNIQLEQYMTPPDITANLFQILHFEEDALENKIVGD
FCCGTGMYSIASSYFNTQKVIGFDVDPNALAICQENIDNAELSDKIEILNYDLLNIQNEE
KYKDYFDTVVMNPPFGTKNNEGIDMKLLSAAIYASKGKVFSLHKESTSKYILKYVKENYP
QVEVELMQKIAFDLPNTYKFHKKKNAVTEVVLVKIDKTKLKKQEDNVNEIKEQLVDLKLQ
DTQDQ