Identifiers and Description

Gene Model Identifier

Contig18735.0.g36

Standard Name

METTL18

Aliases

Contig18735_0_g36

Description

Putative methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000196604.000054831110256e-33hypothetical protein
SGDYIL110W0.00000000000059990805086298HPM1 SGDID:S000001372, Chr IX
from 156045-157178, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18735.0.g36(coding)
ATGGAACTTAACCCCAGGAATATAAAGCAGCTGAAAGTCAATTTGAAAGATGATAGTCAA
ATTTCCTTAACCTACTTGACAATTTCTAATAGAGAAGCATTAATCAGCATAGCCAATGAC
AATCAATAAGTTAACATAAATGAAACTGACTTAATATCAGGATTGTATGAGGGAGGATTG
AAAATATGGGATTGCTCTATAGATTTAGTAAACTATATAGCAAAAAACCCTGAATTAGTT
AAAGGTAAAAATGTGATTGAATTGGGTTGTGGTCAGGGATTACCTGGAATTATTTGTGCA
ACTCATGGTTAAGCTAAGAACTTAATTTTGTAAGACTATAATTAAGACGTATTAGAGAAC
GCCACTTAAAAAGCTTTAGACATTAACTTGTAAAACTTCGGTTCTTAAACCTAGATTGAA
TTATTGCCAGGCTCTTGGGAACATTTATTAAATACTAGACAGGACTTGTAAGGAAAATTT
GATATTGTTCTCATGAGTGAAACTCTTTACAATACGCAGTACTACGATTCACTTTTTGGA
TTTATTGACAGCATACTTACTCAAAATTAAGAGAGTTTTGTATTGATAGGCACTAAGACT
TTCTATTTTGGACTTGGTGGAGGCTATTATGAATTCCAGAAATATATAGAGGAGAAATGG
AGTAGCAAGTTTAAGGTTGAAGTTATTGAAAAGCTTAATGATATGAAGTCTATTGAGAGA
CTGATTTTAAAAATGAGAAGAGTTAGTGATATGGATATTGTTACAAAGGATTTAGAATTC
AAAGCCCAGATCTAAGGAGGAAATTCTTCTTAGAGCCAAAATGATTTCTTTTTGCAATTT
TGA


>Contig18735.0.g36(protein)
MELNPRNIKQLKVNLKDDSQISLTYLTISNREALISIANDNQQVNINETDLISGLYEGGL
KIWDCSIDLVNYIAKNPELVKGKNVIELGCGQGLPGIICATHGQAKNLILQDYNQDVLEN
ATQKALDINLQNFGSQTQIELLPGSWEHLLNTRQDLQGKFDIVLMSETLYNTQYYDSLFG
FIDSILTQNQESFVLIGTKTFYFGLGGGYYEFQKYIEEKWSSKFKVEVIEKLNDMKSIER
LILKMRRVSDMDIVTKDLEFKAQIQGGNSSQSQNDFFLQF