Identifiers and Description

Gene Model Identifier

Contig11945.0.g48

Standard Name

METTL16

Aliases

Contig11945_0_g48

Description

Protein of unknown function (DUF890)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004299909.99648502569394e-38hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11945.0.g48(coding)
ATGACTTAAAATCTAGTAACTCTTGACTTCAAAGATGAAAAAGCTCTACTTGAGTTAACA
AGGGCTATCCTCTATACTTAATATGGATTGGAATACTATGATTTACCTAAGGAGAATTTG
ATTCCTAGAGTGCCCTAAAGAGTTGCTTATCTCGATTGGATAAAACAGTTGTTTGATACA
GTTGAGAAAGAGATTATAAGTGAAAGTATGGAAGAAGAGAATGTAGATGAAAGCAGATAA
TTAATTGGATTTGATATTGGAACAGGTGCAAATTTGATTTATCCAATCTTAGGCATCTTA
AAATACAACATGTAATTTGCAGGAAGCGATATAAACCCAGATTCAATTCATTGGGCCACG
ACTGAGATCCTAAATAAAAACAAAAAATTATAACAAAATTTCATTGGATAAATTCGCTTA
TAAAAAGACTACGAGAGTGTTTTAGAGGGTGTTATAAGTGTCAACGAAATTGATGAAAAG
TTTGATTTTACAATGTGCAATCCACCATTCTTTAATCATGAAGAAGAGAGAACATTTAGA
CATCAATCTGTTTGTCCAATAACAAAGAGCGAAGATTCTACAATAGGGGGCGAGATAAGA
TTTCTTTGTGAATACGCTTAAGAATCACTCAAATTTAAAAATTAGGTAAAATGGTTTACC
TCACTAATTGGCAAAAAGACCACTTATGAGTTTATAAAAAACTACATAGTTAATATGCTT
AAGTTTGATTCTGGTGAGGAGGAGTATGATATATTGATAGCTAGTGGAGAAATTGAAGAA
GGATAGACCAAGAGGTGGTTAATTGGATGGAGATTTATCAAATTGAATTAATTAAAGTAT
TGA


>Contig11945.0.g48(protein)
MTQNLVTLDFKDEKALLELTRAILYTQYGLEYYDLPKENLIPRVPQRVAYLDWIKQLFDT
VEKEIISESMEEENVDESRQLIGFDIGTGANLIYPILGILKYNMQFAGSDINPDSIHWAT
TEILNKNKKLQQNFIGQIRLQKDYESVLEGVISVNEIDEKFDFTMCNPPFFNHEEERTFR
HQSVCPITKSEDSTIGGEIRFLCEYAQESLKFKNQVKWFTSLIGKKTTYEFIKNYIVNML
KFDSGEEEYDILIASGEIEEGQTKRWLIGWRFIKLNQLKY