Identifiers and Description

Gene Model Identifier

Contig21756.0.g14

Standard Name

METTL15P1

Aliases

Contig21756_0_g14

Description

MraW methylase family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001175809.99648502569394e-38MraW methylase family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21756.0.g14(coding)
ATGTACAGGGAAATTCATGAATTGATTGGTAACTATGTTTCAAGCAAGTAAGATGAAAAA
TCTCAGATTTTAATGCTTGACGGTACTTTTGGAGGAGGCAATCATTCAGTTCCTATGCTT
GATAAATATCATCAACTTAGAGTTTTAGGTACTGATTTAGATAGTAAAACTCTTGATTAA
TGCAAGGAAAAGTATGAGAGTCATATTAAAGCGAAGAGATTAGCTCTTGAGCACTCAAAT
TTTGTAAACGCTTTTTCAATCGACCCAAGAGCTGCATTTTTAAAGAAATATGGACTCAAG
ACCAAGTACGATATTATACTACTTGATTTAGGTTTTAGCTCTTATCAACTCGATGATATA
GATAGAGGCCTGAGTTACATGCAAGAAGATTCAAAACTTGACATGAGGTTCGATCAGGAA
AATGAAAATTAAGTTACTGCTCTAGAATTGCTGAACAACTCAACTCAGCTAGACCTAGCT
TAGCTTTTTAAGAAGTTTGGAGATGAGAGGTTTAGTGACTAGCTTGCGAGCAAAATAGTA
AAGTTCAGATAAGGGAGAATAATTTAAACAACTGGAGAACTGAAAGAAGCGATAAGAGAA
GCTTTTCCAACAAGTTCTACAACAGAGAAGAATTAGACTATTAAAAGAATTTTTTAAGCT
TTGAGAATCGCAACAAATCAAGAGTTACTTAACTTGTAAACATTCTTGGAGAGACTTACT
AGAGAGCAGTAATTTTTGGATTCTCAAGCCTTGCTTATGGTTATAACCTTTCACTCACTT
GAGGAGAAAACTATCAGCTAATTTTAAGCAAAATGGAAAAGAAACAAACTTGGTTAATAT
GCCACTAAAAAGCCTATAGAACCTTCACCCGAAGAAATTGAAGAGAACTCTAAAAGTAAA
TCTGCCAAATTATATACTTTCCTTTTTGATTGA


>Contig21756.0.g14(protein)
MYREIHELIGNYVSSKQDEKSQILMLDGTFGGGNHSVPMLDKYHQLRVLGTDLDSKTLDQ
CKEKYESHIKAKRLALEHSNFVNAFSIDPRAAFLKKYGLKTKYDIILLDLGFSSYQLDDI
DRGLSYMQEDSKLDMRFDQENENQVTALELLNNSTQLDLAQLFKKFGDERFSDQLASKIV
KFRQGRIIQTTGELKEAIREAFPTSSTTEKNQTIKRIFQALRIATNQELLNLQTFLERLT
REQQFLDSQALLMVITFHSLEEKTISQFQAKWKRNKLGQYATKKPIEPSPEEIEENSKSK
SAKLYTFLFD