Identifiers and Description

Gene Model Identifier

Contig15740.0.g81

Standard Name

METTL1

Aliases

Contig15740_0_g81

Description

Putative methyltransferase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006214002.0006821221283624e-88putative methyltransferase
SGDYDL201W4.998444157800704e-72TRM8 SGDID:S000002360, Chr IV
from 99561-100421, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15740.0.g81(coding)
ATGAAGCGAAATAGTCAGGAAGCTAAAAAGCAAGATCACGATGACATTGATTCTGATTCA
CACAGTATCAATAATAATGATAACTCACTTGAACCAGGAATGAAAAGAGCTAAAATGCCT
AAGAAGTCAAAGCATAGAATGAGAGCTCATATTAATCCAATGGGAGATCTCACAATTCCA
GTGCCAATGAACACTCAATATGTAGATTGGTCCCTTCATTACCCATCATTCTTTGGATTA
GAAAATAACAACAGCGATAAAATGGTTTGCAACACTGGAAAATTCTAATTGAACTATGAC
ACTAAGGTTGAAGAGCAAAAATCAGATATAGTGCCTACTATGGTGGATATAGGCTGTGGC
TATGGAGGTTTGATGTTCGAATTGGCTAAGGAATTCCCAGATAAATTATGCCTTGGAATG
GAAATTAGAGATAAAGTTACCAATTACGTTGTGCAAAAGATCAACTCATGCAGAATCAAC
TCTTAGTACAAGGACTATATGAATATTGCTGTGGTTAGAACAAACACCATGAAAACCATT
CACAACTATTTCTAAAAGGAATCTCTTGAGAAAATGTTCATTTTGTTCGCTGACCCTCAT
TTTAAGAAGTAAAATCACAGAAGAAGAATTATCACTACTCAATTGTTAAGTGACTATGCA
TATTCCCTGAAAACAGGTGGTAAAATCTACACAGCAACAGATGTGAAAGAACTCCATGAT
TGGGAAGTTGAACATATGGAACTCCACCCAATGTTTGAAAGAGTGCCAGAAGAAGAGACC
AAGGACGACCCATGCATTAAATTTATGACTGAACGCACTGATGAAGCTCAAAAAGTAGCA
AGGAATGGAGGGTCAGTGTGGCATGCTGTTTATATCAAGAAAGATATCACAAAGCAGAGG
GAATAAATCGAAAGGGATGCAATATAATTCTATTTATGA


>Contig15740.0.g81(protein)
MKRNSQEAKKQDHDDIDSDSHSINNNDNSLEPGMKRAKMPKKSKHRMRAHINPMGDLTIP
VPMNTQYVDWSLHYPSFFGLENNNSDKMVCNTGKFQLNYDTKVEEQKSDIVPTMVDIGCG
YGGLMFELAKEFPDKLCLGMEIRDKVTNYVVQKINSCRINSQYKDYMNIAVVRTNTMKTI
HNYFQKESLEKMFILFADPHFKKQNHRRRIITTQLLSDYAYSLKTGGKIYTATDVKELHD
WEVEHMELHPMFERVPEEETKDDPCIKFMTERTDEAQKVARNGGSVWHAVYIKKDITKQR
EQIERDAIQFYL