Identifiers and Description

Gene Model Identifier

Contig478.1.g57

Standard Name

METL

Aliases

Contig478_1_g57

Description

Methyltransferase domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002272401.9999590304423412e-72Actin-binding protein ABP140,
putative
SGDYOR239W4.001202823045957e-54ABP140 SGDID:S000005765, Chr X
V from 784857-785687,7856...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig478.1.g57(coding)
ATGGAGAAACTAGAAGACTATTAATAAGATCAAATCGTGTAGCTGATATAGGAAGAAAAT
AAAGAACCATAAATTAGCTAAAGTCCCTAAGAAGACAACATAAACCAAGAGGAAAACATA
AATACTGAATCTAAAGATGGAAGAGACAAATAAAAAGTAGTTTATTACAAGTGGGATGAA
GAAATGACAGATCAAGCACAAGAGATCTTGAATAAGGAATTATAAAAAATGACTCCACTA
ATGTATGAAAAACTAGAAAAAGATGCGAAGAGAAATTGGGACATATTTTACAAAAATAAC
AAGACTAATTTCTATAAAGATAGACATTACATCAAATTTGAGTTCTCGGAGTTGACAGAT
AAGATTTAAAAGTTGGAACAGGAGGGAGATTTTGTCACTAAATATAGGCTATTAGATGTT
GGCTGTGGAGTTGGAAATGGCTTTTACCCACTTTATAGAGAATTTAAGTAGCATTTATTA
GTGAATTGCTGTGATTTTTCGATTAGAGCAGTGAATTTTGTAAAAGAACATGAATTATAT
AACTCTGACCACATTGATGCATAAGTGTGTGATTTAGTGAACGATGACATACCCTTTTAG
CCATAAACTGCAGATTTCTCGATCATGCTCTTTGTACTCTCTGCAATCTCCCCAGAAAAC
TTTAAGAAAGCAGCACAGAAATTACATAATTAAATGAAAGAAGGAGGCATCCTATATTTC
AGAGACTATGGTAGATATGATCTAGCTTAATTGAGGTTGGCACAGAGAGGCAACTAGAAA
CTATCTGACAATTTTTATATTAGATCTGATAAAACTCGCGCTTATTATTTTACAACTGAA
GAAGTCAAGGAGATTTTCGAATCAGCAGGGTTTGTGGAGTTAGAAAATGATTATCACTAT
AGACTGATTGAAAATAGAAAAGATAATAAGAAAATGCACAGAATTATTCTTAATATATTA
ACATTTGTAATGGGCTGTTGCAAATTAGTCGGAGAGAAAAAACAGAATAAAGTATAAGGA
CATGGCATCTAAACAACTAATGGCGAGACCAAGGGAGCCACTCCAAACAATTTTAACACT
ATGAGCAAGATTTAAGATCCAAGCGCACCTTCATACAAAAGCAATATGACTCCAAATTCA
GGATCAAACTAGAAAAGTGGTGGGTAAACTAATACAGTTGCGATTGGCGTGGACCCCAAC
GTTGGGAGCTACAATCTCGACACCTAGCAAGCATTAATGAATGGCGATACTTAAAGAATG
AAATTTGGCTTTAACGATAAAATTGACAATGAATCTGAGCTAAAAATTAAAAATGAACAG
TCAAATAACCACTTGCAAAACAACAGCTAAAACAAAAATAACGATGAAGAGTAAAAAATA
AATCATACTCGAAATTAAGGGGGAGTGGGGATGTCCCCTACAAGGCTGGAGAAGACTTTG
GATAAAGAAGATACTGGGGACATGAAAAATATAAATCATGATGGCAGAGCTAATACGCAT
TCGGTTGTAATTTAGAACAATAAAGATAGTAATAATGATGGTTAGGACGATAAAGTGTTC
AAATTACCAGCTATTAATAACAAATCAGCTAGAATAGGTGGCAATAACTAGTCAATTGAA
AATAACTCAATAGATAAAAGCAATAATCAATCGAAAGTTTAATCTTAGCATCACACAGAC
AGAAATAATACTAATCAAAAATCAATAGAGCAAGAAGTAGAGTAATAGCAAATGAGCAAA
ATGGAAATCAGGAAGGAAGCACAAAGAATCAAAGAGACAATTGGCACACACAGGAGTACT
ATTAGCCACTAAAACATGCAGCTGAACACAAATATGGCATCGAGCTACGTTGATAATCTT
TTTAACTTATTTGCCCCTCCAGTTAGTTTACCGAAGTAAACTTCCGTCATTTTAGAGGAA
GAACATGAACATTAAGAATAAGTTCTTGACGTGCATGGTATGTAAGATAATTAGCAAGCA
TCCAGTTTCATTGATAACGAGCAGAGAGGCAGTGTGGAGGTATCTAGGGTAAATCCTAAT
AACACCTCAGGTATCGTCCCTTAACCTATTCAAAACATAGCTTCTCCCTCTCAAGTCACA
TAAACTCTGTCTTAACAATAGTCACTTTCAAAGAAGTAAGAAGATGAAGATGATAAGAAG
CAAATTATAGGGGATGTTAGGATTAAGGATGAGCCAGAATCTGAGGATAAAACTCATTCT
CCTAAGAAAGATTAAACTGGATAAGTATCATCACCATCCAAGGTTGAAGATAAAGCATAG
ATGCGCTTGCATCAATTGAACGTAGACACTGAAAGCAATTAGAATCAAAGATATCAACAA
CAATATGAGGAATCTCCAGCACCTAAACTTCAAAACAGACATTAACCCCATTAAAAGCCT
CAAGTAATGCAGCCAATTGACTAAGACATGAAGAGTGCTTAAGATTACATAACAAAGTTG
CTCTCTAGTTAGTAGGATTACTCCAATAATTTCGGTTCAAGTAAAATCAGCAATAAATAA
TCAAATAATAATAGCAAATCTAACCAGGGACAGAGCAGTATTGATGATTCTAGGATGAAC
CCTAACCAGACTAACTCAATGGTAATGACAGGGGCAGTTGTTGATAATCACAATCACAAT
AGCTCATTACCTCATTAACATGAGGAAATTATTGACAATAGAAGTGAATCTCAGATTCAA
GCTGAAGTAGTGAATGAATATATAAGTGAATTGAGAACACAAGTACTTAAATCAATGAGG
GAATGA


>Contig478.1.g57(protein)
MEKLEDYQQDQIVQLIQEENKEPQISQSPQEDNINQEENINTESKDGRDKQKVVYYKWDE
EMTDQAQEILNKELQKMTPLMYEKLEKDAKRNWDIFYKNNKTNFYKDRHYIKFEFSELTD
KIQKLEQEGDFVTKYRLLDVGCGVGNGFYPLYREFKQHLLVNCCDFSIRAVNFVKEHELY
NSDHIDAQVCDLVNDDIPFQPQTADFSIMLFVLSAISPENFKKAAQKLHNQMKEGGILYF
RDYGRYDLAQLRLAQRGNQKLSDNFYIRSDKTRAYYFTTEEVKEIFESAGFVELENDYHY
RLIENRKDNKKMHRIILNILTFVMGCCKLVGEKKQNKVQGHGIQTTNGETKGATPNNFNT
MSKIQDPSAPSYKSNMTPNSGSNQKSGGQTNTVAIGVDPNVGSYNLDTQQALMNGDTQRM
KFGFNDKIDNESELKIKNEQSNNHLQNNSQNKNNDEEQKINHTRNQGGVGMSPTRLEKTL
DKEDTGDMKNINHDGRANTHSVVIQNNKDSNNDGQDDKVFKLPAINNKSARIGGNNQSIE
NNSIDKSNNQSKVQSQHHTDRNNTNQKSIEQEVEQQQMSKMEIRKEAQRIKETIGTHRST
ISHQNMQLNTNMASSYVDNLFNLFAPPVSLPKQTSVILEEEHEHQEQVLDVHGMQDNQQA
SSFIDNEQRGSVEVSRVNPNNTSGIVPQPIQNIASPSQVTQTLSQQQSLSKKQEDEDDKK
QIIGDVRIKDEPESEDKTHSPKKDQTGQVSSPSKVEDKAQMRLHQLNVDTESNQNQRYQQ
QYEESPAPKLQNRHQPHQKPQVMQPIDQDMKSAQDYITKLLSSQQDYSNNFGSSKISNKQ
SNNNSKSNQGQSSIDDSRMNPNQTNSMVMTGAVVDNHNHNSSLPHQHEEIIDNRSESQIQ
AEVVNEYISELRTQVLKSMRE