Identifiers and Description

Gene Model Identifier

Contig13874.0.g61

Standard Name

MES6

Aliases

Contig13874_0_g61

Description

WD domain, G-beta repeat

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

  • ( pfam00400 ) WD domain, G-beta repeat
  • ( pfam03931 ) Skp1 family, tetramerisation domain
  • ( pfam03310 ) Caulimovirus DNA-binding protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYCR072C0.00000009004106436083642RSA4 SGDID:S000000668, Chr III
from 242352-240805, Geno...
T. thermophilaTTHERM_004464300.00000019998969434520019hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig13874.0.g61(coding)
ATGATTAGTATCAACCCAGATGGTACTAGTTCACCACAAGTCGGACTTATTCTGTCATTC
TACAATCAAGTGAACATCTATTGCATCAAGAGAATCCAAAATCAGAGATCTGTAACATCA
GAAACTCTCATTGAGCTTGTCTAAGCTTTCATAGTTCAGGATATTTCAGAGGATATTTAA
GCTTGTGAGTTCAATTGTCACACCAATGAACTGTATTTTGCAGGGGATCTTGGAGTTATC
TATGCTAGTTCAATTGATGAAGCCCATGCACCTTATAGGAAAATGTTTGGTCACTTTAAG
ACTATTACACAGTTGAAAGTTTGCCCCTCAAACTCTCAATTATTGCTCTCTTGTTCAAAC
GATTTCTCTGTGAGACTTTGGGATGTGAAGAAGTAGCTACAGATCATGCTTTTCCTGGAC
ATTGAAGATTAAGTCAGTGAACTCTTGAATATTGATTGGCAACTCGATGGCAGCACTTTT
CTAACATTTGGAATCAACTAGCACCTGAGAGTTTGGGAGATACACTCTAAAGCCAAAACA
CATATTGATAAAATTCTCTAAGATGATTCAATCAAGAAAACATAAGATGTTGTACTTGTA
GAGAATTTCCCAAAACATTGTTACTTTCAAATAATCGAATACTGTGACTATGCCTAATTC
TTTGGCGATGAATTGATTATTTTGAAATCTCCAGTAAACGGAATTCTTTTCATAAAACCC
TTAAACAAGGATGAATTTATGCCAATTAAAACTGTGAGCTTCTAGTAATTTTTGTTAGAT
TCAGTTTCTAACATTGCATTTGTTGGGAGATATGTGCTATCAGGAGACAGCTAAGGAAGG
GTGTTCATGCATAACTTGAGTTACAAAGAAGACTTTACAGATGGCCAGGGAACCTAAAAA
CTAGGAAATGCCTTCGACTAGGAGCAACTCGCAGTCAACTTTATCTCAGCTCTTCAATGG
TAGAATGAAAATGTGGTGTGTGCAGCAAGCAAATTCTCAAATATAGTCAGTGTCACATTC
ACTTAATTTTGA


>Contig13874.0.g61(protein)
MISINPDGTSSPQVGLILSFYNQVNIYCIKRIQNQRSVTSETLIELVQAFIVQDISEDIQ
ACEFNCHTNELYFAGDLGVIYASSIDEAHAPYRKMFGHFKTITQLKVCPSNSQLLLSCSN
DFSVRLWDVKKQLQIMLFLDIEDQVSELLNIDWQLDGSTFLTFGINQHLRVWEIHSKAKT
HIDKILQDDSIKKTQDVVLVENFPKHCYFQIIEYCDYAQFFGDELIILKSPVNGILFIKP
LNKDEFMPIKTVSFQQFLLDSVSNIAFVGRYVLSGDSQGRVFMHNLSYKEDFTDGQGTQK
LGNAFDQEQLAVNFISALQWQNENVVCAASKFSNIVSVTFTQF