Identifiers and Description

Gene Model Identifier

Contig17474.0.g70

Standard Name

MEPCE

Aliases

Contig17474_0_g70

Description

Bicoid-interacting protein 3 (Bin3)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam06859 ) Bicoid-interacting protein 3 (Bin3)
  • ( pfam13847 ) Methyltransferase domain
  • ( pfam13489 ) Methyltransferase domain
  • ( pfam06325 ) Ribosomal protein L11 methyltransferase (PrmA)
  • ( pfam12847 ) Methyltransferase domain
  • ( pfam08241 ) Methyltransferase domain
  • ( pfam08242 ) Methyltransferase domain
  • ( pfam05175 ) Methyltransferase small domain
  • ( pfam02390 ) Putative methyltransferase
  • ( pfam13659 ) Methyltransferase domain
  • ( pfam13649 ) Methyltransferase domain
  • ( pfam08003 ) Protein of unknown function (DUF1698)
  • ( pfam10294 ) Putative methyltransferase
  • ( pfam01135 ) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
  • ( pfam01170 ) Putative RNA methylase family UPF0020
  • ( pfam13679 ) Methyltransferase domain
  • ( pfam05971 ) Protein of unknown function (DUF890)
  • ( pfam01728 ) FtsJ-like methyltransferase
  • ( pfam03484 ) tRNA synthetase B5 domain
  • ( pfam09140 ) ATPase MipZ
  • ( pfam04514 ) Bluetongue virus non-structural protein NS2

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000755802.999534586690157e-23hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17474.0.g70(coding)
ATGGAAAAGCGCGACTAAATGCAAATAGATACTGCACAAGAAAACTCAAGTAAGAAAAGA
AAGAGACAGGAGTTGAAGGGGCCAGCAGGTTATGGGATACCAGATTAATAAAAAAAGAGA
AAAATTGATGAAAACGATGCTGGTTTAAGCGCCCAAGATTAAAATGTTCCCGCAAAATCT
AACTATCAGCAACAACAAGAAATTGAAAAGATTTTATTAAAGCATGAGACTAAATACCAA
GATTTATTAGCTGGCAACAAAGCCTTTTTCAGTGAATTTAAGAATGAGGGATTCTAAAGA
CAAATTGAAAAGGATATTCAGCATTAATCTTTTGGAAATCACGATAAATTCTACAATTTG
CCAAAGGGAGCTAGTTTCTCTCATGTGAACAAATGGCATGATTTGAGACTCGACAAGTTT
TAGGATGAATGGCTAAGAAATAAAACAATTCTAGATGTAGGTTGCGGTACTGGAGTTGTG
GACTTACTTGTAGCTGTAAAGTTTCAACCTAAACTCGTGATTGGAATTGATATTGATCAC
AGGCAAATTAAAAAAGCCATAACTAATATGCAGAAAGCAATCAATGATTAAGAGCAACTA
AATGTTATAGTAGAGCAAGCTGTTAAACACAGAGATGCACTTCAGAACAATGAAGTAGAT
ATGATCGAACAGTATGAAAAACAATAGAAAAGATAGGCTTAAGAAAAAGAACAGAAATAC
AAGGAACTGCTTTTAAAAATCAAAAACTTGCCAATCTCTCTATAAATCACTCTTGAAGGG
AAACTAGCTCATGCTTAGAATGAATCACAGCTTATGATTGTAAACGCCTTGACCAAGGAA
AATTATGAGCCCAATCCTAAGGAAGCAAAGAACTACCTCTATGGAAAAGTTTGCTTTAGA
ACTGAAAACTATATTGAAAATACAGTCATTAGCCAAAAAGAAAAATTCGATGTTGTAATG
TGTCTCTCAACAGTGAAGTATATTCACTTAACTTTTGGAGATATCGGTATAAAGACCCTG
TTCTTAAAAGCTTACGATTAACTCAATTAAAACGGTTTGTTTATATTAGAGAACTAACTC
TGGAAATCTTACAAGAAAAACAAGAACGAATCAGATAGGTCTAAAAAGAATTTCAATGAA
ATAGAGATAAGACCACATTTCTTTAGACAGTACCTCGAGAAAATTGGGTTTGAAATGATT
GAAAGTTTAATGCCAAGTGAAGCAGAGGCTAAAGAAGGATTTGATAGACCTATTATGGTT
TTTAAGAAAGTCTGA


>Contig17474.0.g70(protein)
MEKRDQMQIDTAQENSSKKRKRQELKGPAGYGIPDQQKKRKIDENDAGLSAQDQNVPAKS
NYQQQQEIEKILLKHETKYQDLLAGNKAFFSEFKNEGFQRQIEKDIQHQSFGNHDKFYNL
PKGASFSHVNKWHDLRLDKFQDEWLRNKTILDVGCGTGVVDLLVAVKFQPKLVIGIDIDH
RQIKKAITNMQKAINDQEQLNVIVEQAVKHRDALQNNEVDMIEQYEKQQKRQAQEKEQKY
KELLLKIKNLPISLQITLEGKLAHAQNESQLMIVNALTKENYEPNPKEAKNYLYGKVCFR
TENYIENTVISQKEKFDVVMCLSTVKYIHLTFGDIGIKTLFLKAYDQLNQNGLFILENQL
WKSYKKNKNESDRSKKNFNEIEIRPHFFRQYLEKIGFEMIESLMPSEAEAKEGFDRPIMV
FKKV