Identifiers and Description

Gene Model Identifier

Contig725.1.g115

Standard Name

MEAF6

Aliases

Contig725_1_g115

Description

Histone acetyltransferase subunit NuA4

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam09340 ) Histone acetyltransferase subunit NuA4

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig725.1.g115(coding)
ATGAAAACAGGAAAACAATCAGCCACGGGGAACAATGGTAACCTACTTGTTAACCTCCAA
AGAATTCAGAAGTAGCTAGATATTGAATTGAAAGATATCGAGAGGAAAATCTTTTAAGAT
GAAACTTAATACCTTAAAGACTCACTCTAATTCGGGTCAATAACAAAGGGTTGGGATGGT
ACAGGAAACCAGTAGAAGTCAACTATAGGGCATTAAGGAAGTAGAAAAACTGCTAAATTT
ACCTAAATGGATAGATTATTCTCTTACAGTAGCAAAACAGCACCTACCACTGAAGAAGAG
ACAAAAAATTTCGACAGTAGTGGCTTGACCATGCATAAACTAAAGGGATTAACATTGGGT
AAACAAGGGAAAGGTGGGGTATTTGATAAATCCTTAGTAAGACCCAGTGCAAAGCAGTCA
CTAATAATATCAAGCAAGAACAAGAACAGAAGGCCCAAGAAACCACCTGGTAGCTTGATG
GATATGAGTAACGATGGTGGTGATGATGGCGCAATTGCCAATGGTGTTTAAGAGTTTTTA
TCCGATAATGATGATCCCATGAAGGATGACGAAGAAGAAGAGGGAAGCTCAAACTTCATG
CAAGAGGATTCAGACAATTGA


>Contig725.1.g115(protein)
MKTGKQSATGNNGNLLVNLQRIQKQLDIELKDIERKIFQDETQYLKDSLQFGSITKGWDG
TGNQQKSTIGHQGSRKTAKFTQMDRLFSYSSKTAPTTEEETKNFDSSGLTMHKLKGLTLG
KQGKGGVFDKSLVRPSAKQSLIISSKNKNRRPKKPPGSLMDMSNDGGDDGAIANGVQEFL
SDNDDPMKDDEEEEGSSNFMQEDSDN