Identifiers and Description

Gene Model Identifier

Contig21174.0.g66

Standard Name

MDC1

Aliases

Contig21174_0_g66

Description

BRCA1 C Terminus (BRCT) domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

  • ( pfam00533 ) BRCA1 C Terminus (BRCT) domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006616900.000006997203421143941BRCA1 C Terminus (BRCT) domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21174.0.g66(coding)
ATGCATTTAATTATAAACTTGAATAAAGAAATGAAAACAATTACTCTGATGGATAATCAA
TCAGACTTGGGCACATTTGTCATTGAGTAAAATAGAAAGACTAATTTAAGCGCTTAGCAG
TCATATGAATACAACATTAATGAGAACTTATAAATTCAAATTGGAGATTTCAGAATAGAA
TATCAAAGAAATATTGACGATATTCCACACGTTAAGGATGAGTCAAAGCCAAAGGTAAGC
TTCAAAGAAGATGTCCCCATGAACATACTCGATCATGAAAATGATGAACATCAAGATTTA
TTGGAAATTAATGGTAAAAAAAATAACAACAATATGGGATTTGATGCTACTCTTATCATT
CCACAAAATCCAAAACATAACAATATTCGAAGAATGCCTCCTCCAGTTCCTGGCTTCAAA
AACAATGAAGAGAAGAAAGTTGACAATTTTAGTTTTGGGGATGCCACCTAGATCATTGAA
CCCAAGAAAATGAATGGCTTTTAAATGCCTTAAGCAAGAAAGCTTGAATAGAAAGATATA
GATATGGATGATATGTTTGATGGAGCAACTTAAGTGATATACTTTAACTCTAAAAATGGG
GAATAAAAATCTACATTAGTGGAGGATGATATGTTTGCGGAGACATAGGTCTTGAACAAT
CCATTTTAAAAGGAAATTGATGATGACTATCATGGAGCTACTCTTATAGTTGATTTTCCA
AAGAATAAAAACAAACCTAAGCCATAAGTGCCTGCCTTCAAAGATAATAATGCGTTTATG
AATGATGCTACTCAGTTAATTGATTTTGGAAATGCAAAGTTTGGCAATAAAAATTAAGAT
AGATAAGACAACCAAGTCAATCATGCTAATTTTGATGCTACTTTAATTATTCCTTAAGCT
AAAGAGAAGAAATAAGAAAATTAAAAATCGGCATATGCTGTAAATCAATTTGATGCTACA
CTTATTATTCCTTAAGGTAATCAAGTGAAGAAACCTCAAATTGGAAAACAGTAAGCTCTT
TAGCCAGGTGAAAACTTTGATGCAACTCTAATTATCCCTTAAAATAGCATTAAAAATGGA
TAAAAAGTTGACTAAGTCCTTGAAAAAGAAGAGAAATCTGATTTGGATAGATTGCTTAAC
TCAGACGATGAGGATAATCTGCCAAGATTTGGAAAGCCAGCAAATCCAATTAATAAGAAA
CTACAAAAGTAAAAGAATGGGTCTATCAATTCTTCAATGGATGATTTGATTGATGCTTTA
GACTTCAGTAAAGAAAAGAGGCAAGAAAAGGATATGATCAAGCCATAGTTAGTATAAAAT
AAGAAGGAGTTAGACAAGATTGTAGAGGATAATTTATTAGAAGAGAGTGAAGAGTCAGTG
CAACATAAAGCTTAAAAACCAGGTCCTAAATTTACCCAAGATAAGAAGGTAGGTAAAGAA
GAATTAAAGAAAAATAACAAAAATATTGGGAGGGAAGATCCAATCGATAACAGCTTTGAC
GACATATTAGAAGAAAGAAAAGATGATAAAAAGTAAGAAGCTTAACAAAGTCAAAGATAC
AATAAAAAGAGAAAGGCAGCTGAAATTTCAAATGAGGAGGATTAAGTACAGCAAGATTAA
CCAATTGCAAGTCAATCAAATAAGAAAAGAATTGTCAATGATGATAAGAAGTAGCCATCA
GCAAGACTTAAGAATAAATAATCACAAAAAGTTGTTGAAGAGTCAGAGAGCGAGCAAGAA
GATGATAAAATTAATATTTACAAGCCCTATCGTACTATCCTGGTCAGTGGAGAAGCCAAG
AAACAAGAATATAAGGATATTATAAAGAAGCTTGGAGGCAAGGCTATTGAAGATATCAGT
GAGAATTTTGAAGTCATGGTCACAGATGTTAAGCTTATCAGAAACTGCAAACTGCTTCAA
TCTATCAACCTAGGCGCTAAAGTTGTTAGTGTGAATTGGTTATTGGAATCCTAGAAGAAT
GGAAAGTTTGTAAATATTACCAAGAAGCATGAGAATCATGACAAGAACTTCGAGAAGACC
TATAACTGTAGTTTAAATCAACTCTATAACAACAAGAATGTTGGACAGCTTTTGAAAAAT
TAAACAATTTACATTTCTGATAAAGTGTAGGGAATCACATATGATCAGTTGGTAAGATTG
ATTGAAAGTGCTGGTGGAGAAGTTGCTAAAGAACCAAAGAGGAATGAAAAGCTTAAAAAT
GGTACAATTCAAATTATGGAAGCAACTGCAGACAAGGCAAGAATCAAGAAGATCGATAAA
GATAAGTATCAAGTGCAAAGTGTTCATTTTATATTTGACAGCATTATAGCTTAGAAATTA
GATTTTGAAAAGAACAGTTTAGTTTGA


>Contig21174.0.g66(protein)
MHLIINLNKEMKTITLMDNQSDLGTFVIEQNRKTNLSAQQSYEYNINENLQIQIGDFRIE
YQRNIDDIPHVKDESKPKVSFKEDVPMNILDHENDEHQDLLEINGKKNNNNMGFDATLII
PQNPKHNNIRRMPPPVPGFKNNEEKKVDNFSFGDATQIIEPKKMNGFQMPQARKLEQKDI
DMDDMFDGATQVIYFNSKNGEQKSTLVEDDMFAETQVLNNPFQKEIDDDYHGATLIVDFP
KNKNKPKPQVPAFKDNNAFMNDATQLIDFGNAKFGNKNQDRQDNQVNHANFDATLIIPQA
KEKKQENQKSAYAVNQFDATLIIPQGNQVKKPQIGKQQALQPGENFDATLIIPQNSIKNG
QKVDQVLEKEEKSDLDRLLNSDDEDNLPRFGKPANPINKKLQKQKNGSINSSMDDLIDAL
DFSKEKRQEKDMIKPQLVQNKKELDKIVEDNLLEESEESVQHKAQKPGPKFTQDKKVGKE
ELKKNNKNIGREDPIDNSFDDILEERKDDKKQEAQQSQRYNKKRKAAEISNEEDQVQQDQ
PIASQSNKKRIVNDDKKQPSARLKNKQSQKVVEESESEQEDDKINIYKPYRTILVSGEAK
KQEYKDIIKKLGGKAIEDISENFEVMVTDVKLIRNCKLLQSINLGAKVVSVNWLLESQKN
GKFVNITKKHENHDKNFEKTYNCSLNQLYNNKNVGQLLKNQTIYISDKVQGITYDQLVRL
IESAGGEVAKEPKRNEKLKNGTIQIMEATADKARIKKIDKDKYQVQSVHFIFDSIIAQKL
DFEKNSLV