Identifiers and Description

Gene Model Identifier

Contig12322.0.g18

Standard Name

MCTS1

Aliases

Contig12322_0_g18

Description

PUA domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000524301.9991939848149086e-44uncharacterized domain 2 famil
y protein
SGDYER007C-A 1142

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig12322.0.g18(coding)
ATGTTCAAAAATACTATTGAGGAGGCATTGAATCAGCATCCATTGAAGGCTTCAGTCGCC
AAAACTTTACGTTCTAAAATTGTAGAGACTTATCCAGGTATCGAGGAATATTTAGAGGAA
ATATGGCCAAAGAAGGCCAAGGTTCATCAAACAAAGATAAAAGGTGAATCACACGTTACC
ATGTACTTAATCGACGATGTACTTTCATTTATGGAATTGAGAGACCAGCCAATCATGCCA
ACTTTGAGAATCTTACACAAATACCCCTTTATGATGCCTCATATGCAGTGTGATAAGGGT
GCTATTAAGCATATCTTCAGCGGCAGTAACGTTATGGCACCAGGGCTTACCTCACCAGGT
GGAAACATGGAAGATGTTGAAGCTGGAGAAGTTGTTGCAATTATGGCAGAAGGGAAAGAG
CATGCTATGGGTGTAGGTATCATGTTAATGAGTTCTGATGAGATTAGAAGCTAGAATAAG
GGCATAGCAATTGAACTTATTCAGTTCTTGACTGATGGACTCTGGAAACTTACTAAGCCA
AAGGAATGA


>Contig12322.0.g18(protein)
MFKNTIEEALNQHPLKASVAKTLRSKIVETYPGIEEYLEEIWPKKAKVHQTKIKGESHVT
MYLIDDVLSFMELRDQPIMPTLRILHKYPFMMPHMQCDKGAIKHIFSGSNVMAPGLTSPG
GNMEDVEAGEVVAIMAEGKEHAMGVGIMLMSSDEIRSQNKGIAIELIQFLTDGLWKLTKP
KE