Identifiers and Description

Gene Model Identifier

Contig3310.0.0.g75

Standard Name

MCM9b

Aliases

Contig3310_0_0_g75

Description

MCM2/3/5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00493 ) MCM2/3/5 family
  • ( pfam01078 ) Magnesium chelatase, subunit ChlI
  • ( pfam07728 ) AAA domain (dynein-related subfamily)
  • ( pfam07726 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam04818 ) RNA polymerase II-binding domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007039104.0008150871967356e-141MCM2/3/5 family protein
SGDYGL201C2.9987670792171964e-67MCM6 SGDID:S000003169, Chr VII
from 120907-117854, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3310.0.0.g75(coding)
ATGATAGTGGAAAGACAGTAGAGAGATGCGATGAGAATGAAGCAACTTATGATTGATATT
TGTCATTACTTAGAAGATAAGTACCTAGACGAGATTAAAGCTATAATAACCAACAAAGAA
ACAAACTTGCACTTCGAATTAGATCTAGATTTACTTGATTTTCTGTATCATTTCCCATTT
GAGGGATCCAAATTTCATGAGTATCCAAAAGAATTCCTAAAATTTATCAAGCAAATGTTC
TTCAATGTGCAACAAAAGCTAATCTAATGTGAAGATGAAACGTTTAGATAATTTCTCTTT
CCTAAAAAGCACTTAGATATAAGATTAATTAATGTGCCACCCTTGAAAGAAATTTATCTT
GATACTATCAGAAATTTGAGGCAGTACCACATTAACAAGTTTATGGTAATCTAAGGGACA
GTTATTAGATCATCAAACAACAAAAATAGGGAAACTAAGAAAGATTTTGCATGTAAATTT
TGTGGCAAAATATACAGAGCTACTTCAGATATTTACGAATACACTAGATTCTTGCTGCCA
CCTGTCTGTGGAGGTGAAGTTGAAAGAAAACCAAATCCATTCTATAACATGCTTATGGCT
GCAAGGAAGAGATAAATGGCAAACGGCCAGAATCCTGGACCTATGTTTTAAGGTACAACT
ATTGGATAATGTAATGGAAAGTAATTTGTACCAATAAATGGAACAGCTCAGTATAAAGAC
TATCAAGAGATCAAAATCTAAGAAGTTTATAAGACTTTGAAACCAGGAGTTATACCCAGA
TCAACCATAGTCATTTTTGAAGATGATCTTGTTGATAGAGCCAAACCAGGCGATGATGTA
ATGATTTCAGGAATCTTCATTTAGAGATGGAGATCCCCTTTCAATAGAACAGAGAGACCA
GAAATTGAAGTTGCATTTTTAGCAAATCATGTTATTCAATTAAACAAAAGAGATTTTAAG
AAAGAAATTAACAAGCAAGTGTATGCTGAAATTCAAAAGTTCTGGAAAAGTCATGAGAGA
AATCCTATTGAAGGTAAAAATGAAATTATTGAAAGCATATGTCCTCACATTTACGAAAGA
TACCCAGAAAAGCTTGGAGTACTACTCTGTGTAATTGGCGGAGTTTAAAAGTAACATGAG
AACGACCCTCGTATTAGAGGGCAAATTCACATGCTGATGATCGGAGAACCTGGAACAGGA
AAATCATAGTTATTAAGTTTTGCTTCAAAAATATCAATGAGATCAGTTATGACTACTGGT
ATTGGTACTACTTCTGCTGGTCTTACAGTAGCCTTATTTAAAGATGGAAATGAATATATT
TTAGAAGCTGGTGCCTTGGTGCTTGCTGATTTCGGAGTTTGCTGTATAGACGAATTTTCC
CTGATTAGACCTGAAGATAGAGGCAGTATACATGAAGCTATGGAGCAGTAAACTATCAGT
ATAGCTAAGGGAGGTATAACTTGCAAAATAAACAGTCGTGCTACAATTATAGCAGCAACA
AACCCATGCAAAACTTAGAAATGGAATTCAAGATATGATAATAATCAAAACACTGGTATT
GCTACTTCTCTACTCAGTAGATTCGACATGGTATTTATTTTAGTTGATGAGTGTATTACT
GAATAAGATCTAGCTCAAGCAAATTTTAAGTTAGCTCTGTCTCGTGGAGATGAAGAAGAA
GAGGTAAATTAAAAGATCTGGAGCATAGATAAACTATCAAAGTATATCGTTTATGTTCAA
AGATATATTGACCCAGTTTGCACCGAAAAAGCTGAGATGATTATTCAAGCTTACTTTTAA
TATCTGAGAAACTTAACTACTTTGGGTAAAGATCGAAAAACTGTGAGAATGTTAGAGTCT
CTGATTCGTTTGGCAGAGGCACATGCTAGACTTATGAATAAAAATGACATTGATATTTAT
GATGCCATTTCCGTCATTATACTAATGGAGCACTGTGTAAGTACTGGTCTCTATCAAGAA
ATCCCTCCTGTCATAATGAGCAGATAATTGTATGAAAAAGCTAAATATGAGACACTGATC
CGCTTAGGACTTGAGTTAACTTTCTTTGATGATGAATTCGATTAAATGCTTGCTGATACA
CCCTAGCCTCATTAAAGACCGAATAACATGGGAGATGAGACTGCTTTTAACATGATGGAA
ACTTACTATAACTTAGATAAAACTGAGTCCACTCATGCAGCTGGCAAAAGCCAAAAATCA
TCTGTAAATGGCAAATCTGTTCATTACGTGAAAAGTGAAATTTAAGAGGACTCTATGATA
GTGATTGACTCTAATGGATCTGATGATGAAGTTCAAGCCTCACAGTATGATGATAATTAA
CAGTAAAACAATGCTATTGATCTGTAAAAATTGAAGAAAGAGACTAAACAAGAATATGCT
ATTGAGTAATATGGAAGAGAATAAGATAATAGCAACAATTGTGGAGACGACACTGACCTG
GATGATGCTTAAAGCTAAATCAGTTCAACTTCACAGTATTAATCAAAGCAAAAATTGGAC
TTAAACTTCCAGAAGAAAGGCAATATTAATGAGATATTGCAGCAAAGTTAGCAAGCTAGA
GCCAAGAACTTAGGCAGTAAATTCAAAAACATCATGTAAAACACCAAGAAATACACAGAA
GAGCAGAATAATGAACAGTATGAGAAAGATTCGATATCCGATGGAGAGGGAGACAACTAC
GATAATTAGCAGATTAATTCTTAGTTTATGTAATAAGATAATTAGGATGAAGAAAGCAAT
ATGATTTAATTAGATGGAACAGTCACTGACTATGAAATGGATTGA


>Contig3310.0.0.g75(protein)
MIVERQQRDAMRMKQLMIDICHYLEDKYLDEIKAIITNKETNLHFELDLDLLDFLYHFPF
EGSKFHEYPKEFLKFIKQMFFNVQQKLIQCEDETFRQFLFPKKHLDIRLINVPPLKEIYL
DTIRNLRQYHINKFMVIQGTVIRSSNNKNRETKKDFACKFCGKIYRATSDIYEYTRFLLP
PVCGGEVERKPNPFYNMLMAARKRQMANGQNPGPMFQGTTIGQCNGKQFVPINGTAQYKD
YQEIKIQEVYKTLKPGVIPRSTIVIFEDDLVDRAKPGDDVMISGIFIQRWRSPFNRTERP
EIEVAFLANHVIQLNKRDFKKEINKQVYAEIQKFWKSHERNPIEGKNEIIESICPHIYER
YPEKLGVLLCVIGGVQKQHENDPRIRGQIHMLMIGEPGTGKSQLLSFASKISMRSVMTTG
IGTTSAGLTVALFKDGNEYILEAGALVLADFGVCCIDEFSLIRPEDRGSIHEAMEQQTIS
IAKGGITCKINSRATIIAATNPCKTQKWNSRYDNNQNTGIATSLLSRFDMVFILVDECIT
EQDLAQANFKLALSRGDEEEEVNQKIWSIDKLSKYIVYVQRYIDPVCTEKAEMIIQAYFQ
YLRNLTTLGKDRKTVRMLESLIRLAEAHARLMNKNDIDIYDAISVIILMEHCVSTGLYQE
IPPVIMSRQLYEKAKYETLIRLGLELTFFDDEFDQMLADTPQPHQRPNNMGDETAFNMME
TYYNLDKTESTHAAGKSQKSSVNGKSVHYVKSEIQEDSMIVIDSNGSDDEVQASQYDDNQ
QQNNAIDLQKLKKETKQEYAIEQYGREQDNSNNCGDDTDLDDAQSQISSTSQYQSKQKLD
LNFQKKGNINEILQQSQQARAKNLGSKFKNIMQNTKKYTEEQNNEQYEKDSISDGEGDNY
DNQQINSQFMQQDNQDEESNMIQLDGTVTDYEMD