Identifiers and Description

Gene Model Identifier

Contig3653.0.g111

Standard Name

MCM9a

Aliases

Contig3653_0_g111

Description

MCM2/3/5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_007039102.9994339188023638e-146MCM2/3/5 family protein
SGDYPR019W6.000161128365848e-68MCM4 SGDID:S000006223, Chr XVI
from 596750-599551, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig3653.0.g111(coding)
ATGGCCAGTAATGCTAATGAAATTATGGAATATTTTATGAAAGAATCTTATGACTAATTA
GTGCCAATACTTATGGGGGAGGATACTATAATTTATTATGATATCACTGTTGATTTGCTG
GATTTCATTTATAACTTTCCATTTCTGGGAGGTAAATTTCATGAGCACCCATTTGAATTT
CTTGAATTTCTGAAAGATACTCTAGTTGCTTGTTAACAAAAGATTGTTGAAAAGGACGAG
GATAAACTGCCAGTTAATGTTGTAGTGAAAAAGAACCTAGATGTGAAACTTTTAAATATA
CCCCCTACTAAGGAAGTGGTTGCTGAGTCTATAAGAGCTGTAAATACAGAATACCAAAAC
AAATTTATTATCTTGACTGGGACAGTAGTTAGGACAGGACATGTAAACAGCAGAGAACTC
TTTAAGCAATTCAAATGCAGATAGTGCGAAAAAGAGTTTACTTGTGAGTCAGATATCACA
GAATACAATAATTTCAAGCTACCCTAACGATGCGATGGTAAAGTATAAACTAAAGAGAAC
CCTTTCTTTAAAATAGCTAAAACTCTAATAAACAATATCAAGAACAAAAACATGAAGGGC
TAGTTAGATGAAAATTAAAATTTCGATAATCCTAAGAGAGAAGCTAATACTGGTTTTTAA
ACTTCAGCGTGCAAAAGTAAATCTTTCTAACCTGTCGATGGAACAAGTGAGTTCAGTGAT
TATTAAGAGATCAAACTTTAAGAGTTATTCAAAACTCTCAAACCAGGTCTTATTCCTAGA
TCTATGATGGTTATTCTATAGAACACATTAGTTGAGATTTGTAAACCTGGCGATGATGTG
ATGATAACAGGAGTTTTAATTCAAAGATGGAAAAATATGCCTCCTGCTCCAGGGACTAGA
CCTTTTATTGAATTAGCATTATTAGCAAACAATGTGGAAGTCTTGAACAAAAGAGAATTT
TCAAAGAGTAATTCAATTAACATGGATACTCTCAATGAATTCAAAAGATTTTGGAGAAAG
CATGATCCTATCATTGGTCGTTAGATACTCATTAAGAGTGTATGTCCTAATATCTATGAA
AGATATGATGTCAAGTTAGGGCTTCTACTTTCCCTGATTGGTGGAGTAGCTCAACATTAA
GAAGAAACCAAATTCAAAGTTAGAGGTTAAGTACACTTGTTGATGGTTGGAGAACCAGGA
ACTGGAAAATCCTAGATGCTTTAAGCAGCAACTCATTTGAGCTAAAGGTCAGTCTAGACT
ACTGGCATTGGTACTACATCTGCAGGATTGACTGTATCTTGTTTTAAAGATGGCGCTGAA
TATGTTCTTGAGGCAGGGGCACTTGTCCTAGCAGATTGTGGAGTATGCTGTATAGATGAG
TTTTCGCTTATAAAAAATGATGACAGAGCTAGTATCCATGAAGCTATGGAATAGTAAACT
ATCAGTATAGCTAAGGGAGGAATTGTTTGCAAAATAAATACTAGAACTACAATTATTGCT
GCTACAAATCCTGGAAGAACATAGAAATGGGATCCAAATTATGATCTGCAGTAAAATACT
GGAATAATGAGTAGTTTGCTATCTAGATTTGATTTGATCTTTATTATGCTAGATGAGCAT
TAAGTTGAAGATGACATTCAAAAAGCTGATTTTGTTCTTAACAGATCTTGCCTAAACAGA
TCTGAAGTAAAGCAAGAGTTTCAATTATGGCCATAAGAGAAATTAGCAAACTACATTAAT
TTCGTTCAGAAAGTCTTTGAGCCTGTAGTTACTGAAGAGGCTGAGATAATGCTTAAAGCT
TATTTTGCATACTTGAGAATGAATCCAAAAGTTAATAAAGATCGAAAAACTGTGAGAATG
CTTGAAAGTATCATAAGAATGACTGAAGCTCATGCAAGACTTCTAATGAAAAGTTAAGCA
ACTGTGTTCGATGCTATATGTGTAATTATTCTTATGGAACATACTCTGATGACGAATCTA
TTTGGCAGTGAAATTTTACCATCTATTATTATGAGGAGCGCTATTGAATATAAGCAAATC
AGAGATGATTTAACTTATAGACTAGGATTAGATGGCATTTGCTTTGGTGAGTAAGATGAG
TCAATCGAGCTCTATAAATAATGCTAAACTCCATCTCCAGTAAAAAGACTAGAAGACTCA
ATGTTTATAAACAATGCTGAGTCAAATTTCGATTTTTCTTTTGTAGGTGGCTCTGAATTC
TCTTTCTAATCTTAAGACGAGCAATCTCACTTTTTTCGATAAAATTCTTAGATAAATGGT
TTCAAGCACAATTCTTCAAACTTAATGAGGTCTAATAATGGTTCTTAAATGCCTAATTTC
AAAATTCATAATAGTGGTTCTTAATCCTTGAACTCTCTTTCATCATAAAGTCTAGCTAGA
AACTTAGGTTAGTAACTTTAACATTCCTCAACTCTTTAAAAATCAAATTCACAGCTTCTT
GATTTGAACATAAGCAAGACCACGGAAAAGTATCTTGAAAATTAAATAGTTATACCAGAA
GAAAATAGTAGTGAGCTGATATTGAATGATGACCTCTTTAATGGCATGTCTGAGCTTAGT
GATACTAGCAATAATTTTTAAGATTTACTTAGCGATCTTTCTCAAATAACCAGCTGCGAT
AGATATGCAAATCAAGAATTGAAAGAAAACCCAATTATTGAGATATAGTAACCCAGTTTA
CAAGAAGAAGCGAAAGTCTTAGAATCGTAAATAAACTAGTTATAAGCACACATTTAAGCT
AATTTAGAAGAGGAAAGTAATCATGATCAGCAAGTTACAGTTTCAGATTTTATGGAGAAT
GAAATACTATATGAAACTAAGAGCTAACATATAAATTAAGGTCTTATCCAAGTATAATAG
TCTTAACAAATTAATAAGGAATGGGACCAGTTCTAAACATAGATAAATCAGAAATAGATT
GACAAACCTGAAGATCAAACTCTCACAAAAAAGAATTTGTTACTGACTAAATTCAAACTA
TGCACAGATTAAAACGCAAAAATATTATCTTAAGTAGATGACTAGATCTAGAATTTATAG
TGTGATATCTTTAATTAGAGTAAAAACTAAGATTAGCAAGAAAATATACAGAGAATTAAT
GCAACAAGCAAAGGAGTAACAATTTTGGATGACTTAGAAGAATATGATGAATAGAGTTTA
ATTTAATAATCTCAGTAAGAAATTGATTAATAAATTAACCAGGGAAATGATTAAATTATT
GAAAATAATGAAGATGATGATGATAATGATAATGACTTTTTATTCGATTGA


>Contig3653.0.g111(protein)
MASNANEIMEYFMKESYDQLVPILMGEDTIIYYDITVDLLDFIYNFPFLGGKFHEHPFEF
LEFLKDTLVACQQKIVEKDEDKLPVNVVVKKNLDVKLLNIPPTKEVVAESIRAVNTEYQN
KFIILTGTVVRTGHVNSRELFKQFKCRQCEKEFTCESDITEYNNFKLPQRCDGKVQTKEN
PFFKIAKTLINNIKNKNMKGQLDENQNFDNPKREANTGFQTSACKSKSFQPVDGTSEFSD
YQEIKLQELFKTLKPGLIPRSMMVILQNTLVEICKPGDDVMITGVLIQRWKNMPPAPGTR
PFIELALLANNVEVLNKREFSKSNSINMDTLNEFKRFWRKHDPIIGRQILIKSVCPNIYE
RYDVKLGLLLSLIGGVAQHQEETKFKVRGQVHLLMVGEPGTGKSQMLQAATHLSQRSVQT
TGIGTTSAGLTVSCFKDGAEYVLEAGALVLADCGVCCIDEFSLIKNDDRASIHEAMEQQT
ISIAKGGIVCKINTRTTIIAATNPGRTQKWDPNYDLQQNTGIMSSLLSRFDLIFIMLDEH
QVEDDIQKADFVLNRSCLNRSEVKQEFQLWPQEKLANYINFVQKVFEPVVTEEAEIMLKA
YFAYLRMNPKVNKDRKTVRMLESIIRMTEAHARLLMKSQATVFDAICVIILMEHTLMTNL
FGSEILPSIIMRSAIEYKQIRDDLTYRLGLDGICFGEQDESIELYKQCQTPSPVKRLEDS
MFINNAESNFDFSFVGGSEFSFQSQDEQSHFFRQNSQINGFKHNSSNLMRSNNGSQMPNF
KIHNSGSQSLNSLSSQSLARNLGQQLQHSSTLQKSNSQLLDLNISKTTEKYLENQIVIPE
ENSSELILNDDLFNGMSELSDTSNNFQDLLSDLSQITSCDRYANQELKENPIIEIQQPSL
QEEAKVLESQINQLQAHIQANLEEESNHDQQVTVSDFMENEILYETKSQHINQGLIQVQQ
SQQINKEWDQFQTQINQKQIDKPEDQTLTKKNLLLTKFKLCTDQNAKILSQVDDQIQNLQ
CDIFNQSKNQDQQENIQRINATSKGVTILDDLEEYDEQSLIQQSQQEIDQQINQGNDQII
ENNEDDDDNDNDFLFD