Identifiers and Description

Gene Model Identifier

Contig19212.0.g9

Standard Name

MCM8c

Aliases

Contig19212_0_g9

Description

MCM2/3/5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam00493 ) MCM2/3/5 family
  • ( pfam07728 ) AAA domain (dynein-related subfamily)
  • ( pfam01078 ) Magnesium chelatase, subunit ChlI
  • ( pfam00004 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam07726 ) ATPase family associated with various cellular activities (AAA)
  • ( pfam00158 ) Sigma-54 interaction domain
  • ( pfam13401 ) AAA domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010310609.997093137033517e-262MCM2/3/5 family protein
SGDYBL023C3.9983507938127826e-75MCM2 SGDID:S000000119, Chr II
from 177526-174920, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19212.0.g9(coding)
ATGAGACCCAATGACTTTAAGCATCTTGCAATTTAAGTGTTCTTTGAAGCTTTCTCAATG
GAGGAATATCAAAAATACTTAGAATGGGAGAAAAAAGAGGATAATAACTACGAAGCAGTG
GTTGTGTATATTAACTACGCTTAATTTTTCCAATGTGGGAATGCAAATATCAAGCAATTC
CTTGAGTTTATATACGAGCACCCTAATGATTTGATAAAATGTATAGCTATTGCACTAGAT
TGCGTGAGATTTTTCGTATTAAAACTTCAAGATGGCAAAACAGTCACTGTGAGATTTACG
AATTACTGTAATGTTTACGCATTATCAGCAATTAAAAGTCATTTAATTGGAAAATTTATA
TGCTTAAGAGGTACTGCACTAAGAGTATCCTCTATGAAAGTGCTCGTCTAATCAATTCAA
TTTACTTGTCATGAATGCAAAGCTAAAATAATTATTCACTTTATAGATGGAAAGTGGGAG
ACGCCAAATAGATGCATCAACATGGATTGCCGAAGTAGAATATTCAACCCCGAAAAGCAC
ACAGCTAAAACCTCATTTTACTAAAGGTTAAGAATTTAAGAAATCGAAAATGACATGAAA
GATATTAATGCAGGGAAATTGCCTAAGACTATTGATTGTGAAATTAGAGATGATCTCATA
GATACCATCATAAGTGGAGATATAGTTACAATATGTGGAATTATGAAAACTGAACTTCAA
AATGATATGAAAGGTTTTGGTGGAGGAAAGAACGGCAAAAATAAGGCGCTTCATGCTTCA
TATATAGATGTAAACTCAATAAGAAACTCTAACGCTGACTATTTCTTATCAACTGGTGCA
AATGAATAGGGTGCTTCATTAGTTATGAATGGAAACAAAGTTAATATTTCAGAACTCAAT
GAGATTCATAAATTGGCAGAGAGGAAAGATATATTTTATCTACTGATTAAATCACTATGC
CCATCGATTTATGGTCATGAACTAGTAAAAGCTGGCTTATTATTGGCGATGTTTGGAGGT
TCAGATAATCGAATAAAAAACAAAGGAGAGTTTTAAGATTACGTTATTAAAAATGATGAT
AAAAATGGTTAGTAGCAAGATGATGAGGAAGAAGACAAGAATACTAATTGCAGACCGGAC
ATTCACATGCTGATGGTTGGAGACCCAGGTCTTGGTAAATCTTAAATGCTTAAGCATATC
GTCAGTGTGGCGCCTAGAGGAGTCTATGTTTGCGGTAATTCAACTACCAATGCTGGTCTT
ACAGCTACTCTTATCAGAGATTAGTTCACAAATGAGTAAACCTTGGAAGCTGGAGCTTTG
GTATTGAGTGATTTGGGCATATGCTGTATAGATGAGTTCGATAAAATGACAAGCGATTAA
AATTCTTTGCTTGAAGCTATGGAACAGTAAACTATTTCAATTGCTAAGGGAGGTATCTTA
GGCTCTCTGTCTGCTAGATGTACCATTATTGCTTGTGCTAATCCTCATACTGGTCATTAT
AACAGATCAAGAACAATCCTTGAAAATATCAGAGTCTCAAATGCTATTCTATCACGTTTT
GATTTAGTGTTTTTGCTTTTGGACGATCCTGATCTTTAAAGAGATAGAAAACTTTCAGAG
CATGTTATGAAACTTCACTCCAGAAATCGTAAAAGAAAACTTGACATGTTTGCAAGTGAG
TTATAGGAGTAGTAAAATATTGAAGGAGGATCTAATTACCAGAGTAGCTTTCTAGGTCTT
GATAAAGTTGTAAAGAGAATGAAATATGCAGACTCAGCAAATTCTTCCTAGGCTGGTATT
GATGACGACGACGAACTTCAAGAAATCGTAATGAATTAGTCTCAAATGTCAAATCGGGAA
CAAGAAATTTAATATGCCTCATTAACTCAAAAAGTAAAGACTTTAATGGAGAAAATCAAA
GAATCGGAATAAATCTAGCCATAGCTTTTGAAAAAGTATCTATCATTCGCTAAACACACA
GTATTTCCAAAACTCTCAATCGAGGCTTGTGAAGTGATCAAGGACTTTTACATCTCTTTA
AGAATTAATGCAGTAAATAACGCTAATTCTCTCCCTATAACTTCAAGACAGTTAGATTCG
CTTATAAGACTAAGTGAAGCTCGAGCTAAATTAGAATTCAGGAATTTAGTAACAAAGTAA
GATGCTATGGACGTAGTGAAGCTCGTGCAAGAATCCCTATTTGAAGCTTGTTACATGGAA
ATGATGAATGTAAACAGAAGCATGATGAACGGAGGTGGGTATGGATAAAATTAGAACTAA
GTGAACAATGGGAATGGATAGAGTGAATACAACAACAATAGCTACTTCTCAAATGGCCAA
TATCAGTAATAAAATTCAAACAATTATAACAACAGTGGAAACAGAAGTGGTTCTGCTTCT
TAAAGAGGAAGAGGTGGGCAATCTCAGTAACAAATAGATGTCATGAATGCGAATGTAGCT
ATGATGTCAATACCTAAGTAAACTAAAGTTTACGTTGAGAGGTTAAGAAGTGAGGCTGAT
ATGCGTTAGAGTAAGCTCTTTGAGTTCAACGAAATGATTAGAATTGGCAAGGAAATCAAT
TTGCAAGTAGGCGATTTCAAGCAATTTTTAGATAAGCTTAATAGTCAAGGTATACTTATC
ATGAAACCAAATAAAGTATGGGAATTAAATTGA


>Contig19212.0.g9(protein)
MRPNDFKHLAIQVFFEAFSMEEYQKYLEWEKKEDNNYEAVVVYINYAQFFQCGNANIKQF
LEFIYEHPNDLIKCIAIALDCVRFFVLKLQDGKTVTVRFTNYCNVYALSAIKSHLIGKFI
CLRGTALRVSSMKVLVQSIQFTCHECKAKIIIHFIDGKWETPNRCINMDCRSRIFNPEKH
TAKTSFYQRLRIQEIENDMKDINAGKLPKTIDCEIRDDLIDTIISGDIVTICGIMKTELQ
NDMKGFGGGKNGKNKALHASYIDVNSIRNSNADYFLSTGANEQGASLVMNGNKVNISELN
EIHKLAERKDIFYLLIKSLCPSIYGHELVKAGLLLAMFGGSDNRIKNKGEFQDYVIKNDD
KNGQQQDDEEEDKNTNCRPDIHMLMVGDPGLGKSQMLKHIVSVAPRGVYVCGNSTTNAGL
TATLIRDQFTNEQTLEAGALVLSDLGICCIDEFDKMTSDQNSLLEAMEQQTISIAKGGIL
GSLSARCTIIACANPHTGHYNRSRTILENIRVSNAILSRFDLVFLLLDDPDLQRDRKLSE
HVMKLHSRNRKRKLDMFASELQEQQNIEGGSNYQSSFLGLDKVVKRMKYADSANSSQAGI
DDDDELQEIVMNQSQMSNREQEIQYASLTQKVKTLMEKIKESEQIQPQLLKKYLSFAKHT
VFPKLSIEACEVIKDFYISLRINAVNNANSLPITSRQLDSLIRLSEARAKLEFRNLVTKQ
DAMDVVKLVQESLFEACYMEMMNVNRSMMNGGGYGQNQNQVNNGNGQSEYNNNSYFSNGQ
YQQQNSNNYNNSGNRSGSASQRGRGGQSQQQIDVMNANVAMMSIPKQTKVYVERLRSEAD
MRQSKLFEFNEMIRIGKEINLQVGDFKQFLDKLNSQGILIMKPNKVWELN