Identifiers and Description

Gene Model Identifier

Contig8140.0.g57

Standard Name

MCM8b

Aliases

Contig8140_0_g57

Description

MCM2/3/5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010310604.0019235632881006e-109MCM2/3/5 family protein
SGDYEL032W1.999385218781115e-51MCM3 SGDID:S000000758, Chr V f
rom 86937-89852, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8140.0.g57(coding)
ATGACTTCTGTTAACAAACAATACTACCCGCAAAGAAGCAACAATTAAGTGAGACCACAT
CACTAGCAGTCTGATGATGATGAACTCAATGGTTATGGGGGTGGCAATGCTGATTAAAAA
GCTAAAACTAACTATCAAACAAGTGCTAAATTATCTTATCACAACCAACGTGACAACAGA
GGAGGCAATCCATTAAGTGGAAATTTTGACAAAAACAAGCTTCTGCACAGATGGAATCAC
TATTTCCCTCATGAACTTGTCAAGACTTTCGATGCAAGTGATTTCAAACATCTTGCAATT
CAAGTGTTCTTTGAGACATTCTGTCAAGATTAGTTTCAGCAATTTGTTACTTGGGACAAG
TCCTCAGAGAACTACGACAACATAATCGCTCACTTAAACTTCTCAGGCCTATACTAGCAC
TGTAATTCACAGCTTAAATAGATACTAGAGTACCTCTATGAACACCCAACTGAGCTTATT
AAATGCGTTGCTTTGGCTTTAGATTCAGTTCGTTTCTTAAACTTCAATCATGTGTACCCA
CTGTCCCTGATTAAGTCTCACTTAATCAATAAGTATATATGCTTGATTGGAACTGTGCTT
AGAGTGAGCTCCATCAAGGTACTTGTGGAATCTATTTAGTTTCAATGCTATGACTGTAAA
TCTAAGATACTCATAAACTTCATAGATGGAAAATGGGAGAATCCAAACAAGTGCATTAAT
ATGGACTGCAAAGGAAAAACTTTCGTTCCAGAGAAACACACAGCGAAGACTAGTTTTTAT
CAGAGAATAAGAATCCAAGAAATTGATAACGATATGAGAGATATCAATGCTGGAAAGCTA
CCTAAGACTATAGACTGTGAAATCAAAGATGATCTTATTGATGCCTGTATCAGTGGGGAT
ATTGTTACAATCTGTGGGATTATGAAGACAGAATTGCAGTAAGATATGAAGGGCTTTGGG
GCGTAAAAAGCCAATAAGAATAAAGCCTTGCATGCCTCCTATATTGATGTGAATTCTATT
AAGAACTCAAACACTGAGTATTTCTTATCAAGTGCTGCTTCTGCAAACCAAACATCCACT
ATGTCTTCAAGCACTGAGAACAAAGTGAACATGCACGAACTAAATGAAATACAAAATTTG
TCGCAGTAGAGATCTAGAAAGGGTGATTTATTTGCACTTTTGATTAAATCTATATGTCCA
AGCATTTTTGGGCATGAGTTGGTCAAGAGTGGCTTGGTGCTCAGTTTATTCGGTGGTACT
GACTATAGATTGAAGAATAGCAAGGAATTTGCAGAATTGATGTATGACAAGAATGGAGGG
CATATTGAAGAAGAAGCCGAAGATGATTAAGGGTAGAATTCATCGAATCAACAGAACATT
CGTCCAGATATCCACATGTTAGTAGTGGGTGACCCTGGCATGGGTAAATCCCAGATGTTG
AAGCACTTAATCAATGTGGCTCCCAGAGGTGTCTATGTATGCGGCAACTCCACTACAAAT
GCTGGACTCACTGCAACTCTAATAAGAGACCCCATGACCAACGAGTAAAATTTAGAAGCA
GGTGCACTTGTCCTCAGTGATCTCGGTGTTTGCTGCATTGATGAATTTGATAAGATGACA
AGTGACTAGAACACATACTTGAAGCCATGGAATAGCAAACTATATCCATTGCGAAGGGTG
GTATACTTGGCAGTCTAAGTGCTAGATGCAGTGTTGTTGCTTGTGCAAACCCTGTTTCTG
GTCATTACAAGTAAGTCAAACAATCAAATAAATAATGTGTTATATAGCCGATCAAGAACC
ATATTGGAGAATATCAAAGTATCAAATGCTATTCTATCTCGTTTTGATTTGGTATTCTTG
CTTTTGGACGATCCAGATACACAGAAAGATAAGAAACTGAGTGAGCATGTTATGAAACTC
CACTCTAGGAATAGAAAGCGCAGACTTGAGAATATCTATGGCGGAGGTGGTGCATACTCA
GAGTTGAGTGCAGGCGGCAACCCACCATTTTCTCTGAATATAAATTCCTCAGCTGATCGC
AGTGGCAACGAGTTTTCTGTTAGTGGTGGGGGACATCACGCCAAGAGATTAAGCACAACA
ACTTCTACTCTCAATCATCACAAGATGATGACTAGCCCAGACCACAACCTCTCACTCAAA
CTGATTTCATTAACTACACATCATTGCAGCAGAAAATCAAGCATTAATGTGATAGAATCA
GTGATGATGACTGCTCTCCCTATTCTTCTAAAAAAGTACATTTCATATGCAAAGCACACT
ATCTTCCCTAAACTTTCACTTGAAGCGTGTGAAGTACTCAAAGATTTCTATATCACTCTA
AGAGAAAATGCAAGTCAAAACAGTGCAAACTCCCTCCCTATCACTTCAAGATAATTGGAT
TCACTAATCAGACTGAGTTAAGCAAGAGCTAAGATGGAATTCAGATCAGTGGTGACTAGA
GAAGATGCTCTTGACATAGTGAGATTAGTCTAAGAATCTTTATTTGAAACTTCCTACGTT
GATTTTAATCAAAAGTATGGCGGTTACAATGGGTCATTCTCTAGTTAGATGACATCATCA
ACTATGAATGGGAAAGGAAAGTCAAACTAAGTAGATCTCTCAAACATCTCCAGTTTATCA
GTCCCTAAACAAACCAAGCTATACGTCGATAGATTGAGATATGAGGCTGAGTAAAAGGGC
AATAAACTTTTTGATTTCCAGGAGATGATTAAACTTGGCAAAGAAATGAACTTGTAAGTT
GGTGATTTTAAATTATTTTTGGAGAAGTTAAACATGCAAAATGTTATCATCATGAAGCCT
AATAAGCAGTGGGAGCTATTGTGA


>Contig8140.0.g57(protein)
MTSVNKQYYPQRSNNQVRPHHQQSDDDELNGYGGGNADQKAKTNYQTSAKLSYHNQRDNR
GGNPLSGNFDKNKLLHRWNHYFPHELVKTFDASDFKHLAIQVFFETFCQDQFQQFVTWDK
SSENYDNIIAHLNFSGLYQHCNSQLKQILEYLYEHPTELIKCVALALDSVRFLNFNHVYP
LSLIKSHLINKYICLIGTVLRVSSIKVLVESIQFQCYDCKSKILINFIDGKWENPNKCIN
MDCKGKTFVPEKHTAKTSFYQRIRIQEIDNDMRDINAGKLPKTIDCEIKDDLIDACISGD
IVTICGIMKTELQQDMKGFGAQKANKNKALHASYIDVNSIKNSNTEYFLSSAASANQTST
MSSSTENKVNMHELNEIQNLSQQRSRKGDLFALLIKSICPSIFGHELVKSGLVLSLFGGT
DYRLKNSKEFAELMYDKNGGHIEEEAEDDQGQNSSNQQNIRPDIHMLVVGDPGMGKSQML
KHLINVAPRGVYVCGNSTTNAGLTATLIRDPMTNEQNLEAGALVLSDLGVCCIDEFDKMT
SDQNTYLKPWNSKLYPLRRVVYLAVQVLDAVLLLVQTLFLVITSKSNNQINNVLYSRSRT
ILENIKVSNAILSRFDLVFLLLDDPDTQKDKKLSEHVMKLHSRNRKRRLENIYGGGGAYS
ELSAGGNPPFSLNINSSADRSGNEFSVSGGGHHAKRLSTTTSTLNHHKMMTSPDHNLSLK
LISLTTHHCSRKSSINVIESVMMTALPILLKKYISYAKHTIFPKLSLEACEVLKDFYITL
RENASQNSANSLPITSRQLDSLIRLSQARAKMEFRSVVTREDALDIVRLVQESLFETSYV
DFNQKYGGYNGSFSSQMTSSTMNGKGKSNQVDLSNISSLSVPKQTKLYVDRLRYEAEQKG
NKLFDFQEMIKLGKEMNLQVGDFKLFLEKLNMQNVIIMKPNKQWELL