Identifiers and Description

Gene Model Identifier

Contig7673.0.g5

Standard Name

MCM8a

Aliases

Contig7673_0_g5

Description

MCM2/3/5 family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010310607.0010636619989215e-130MCM2/3/5 family protein
SGDYBL023C4.001670058321624e-73MCM2 SGDID:S000000119, Chr II
from 177526-174920, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7673.0.g5(coding)
ATGACTTCTGTTAACAAACAATACTACCCGCAAAGAAGCAACAATTAAGTGAGACCACAT
CACTAGCAGTCTGATGATGATGAACTCAATGGTTATGGGGGTGGCAATGCTGATTAAAAA
GCTAAAACTAACTATCAAACAAGTGCTAAATTATCTTATCACAACCAACGTGACAACAGA
GGAGGCAATCCATTAAGTGGAAATTTTGACAAAAACAAGCTTCTGCACAGATGGAATCAC
TATTTCCCTCATGAACTTGTCAAGACTTTCGATGCGAGTGATTTCAAACATCTTGCCATT
TAAGTGTTCTTTGAGACATTCTGTCAAGATTAATTTCAGCAATTTGTTACTTGGGACAAG
TCTTCAGAGAACTACGACAACATAATCGCTCACTTAAACTTCTCAGGCCTATACTAGCAC
TGTAATTCACAGCTTAAATAGATACTAGAGTACCTCTATGAACACCCAACTGAGCTTATT
AAATGCGTTGCTTTGGCTTTAGATTCAGTTCGTTTCTTAAACTTCAATCATGTGTACCCA
CTGTCCCTGATTAAGTCTCACTTAATCAATAAGTATATATGCTTGATTGGAACTGTGCTT
AGAGTGAGCTCCATCAAGGTACTTGTGGAATCTATTTAGTTTCAATGCTATGACTGTAAA
TCTAAGATACTCATAAACTTCATAGATGGAAAATGGGAGAATCCAAACAAGTGCATTAAT
ATGGACTGCAAAGGAAAAACTTTCGTTCCAGAGAAACACACAGCGAAGACTAGTTTTTAT
CAGAGAATAAGAATCCAAGAAATTGATAACGATATGAGAGATATCAATGCTGGAAAGCTA
CCTAAGACTATAGACTGTGAAATCAAAGATGATCTTATTGATGCCTGTATCAGTGGGGAT
ATTGTTACAATCTGTGGGATTATGAAGACAGAATTGCAGTAAGATATGAAGGGCTTTGGG
GCGTAAAAAGCCAATAAGAATAAAGCCTTGCATGCCTCCTATATTGATGTGAATTCTATT
AAGAACTCAAACACTGAGTATTTCTTATCAAGTGCTGCTTCTGCAAACCAAACATCCACT
ATGTCTTCAAGCACTGAGAACAAAGTGAACATGCACGAACTAAATGAAATACAAAATTTG
TCGCAGTAGAGATCTAGAAAGGGTGATTTATTTGCACTTTTGATTAAATCTATATGTCCA
AGCATTTTTGGGCATGAGTTGGTCAAGAGTGGCTTGGTGCTCAGTTTATTCGGTGGAACT
GACTATAGATTGAAGAATAGCAAGGAATTTGCAGAGTTGATGTATGACAAGAATGGAGGG
CATATCGAAGAAGAAGCTGAAGATGATTAAGGGTAGAGTTCATCAAATCAACAGAACATC
CGTCCAGATATCCACATGTTAGTAGTGGGTGACCCTGGCATGGGTAAATCTCAGATGTTA
AAGCATTTAATCAACGTGGCTCCCAGAGGTGTGTATGTATGCGGTAACTCCACTACAAAT
GCTGGACTCACTGCAACTCTCATCAGAGACCCCATGACCAACGAGTAAAATTTAGAAGCA
GGTGCACTTGTCCTCAGTGATCTCGGTGTTTGCTGCATTGATGAATTTGATAAGATGACA
AGTGACTAGAACACATTACTTGAAGCCATGGAATAGCAAACTATATCCATTGCGAAGGGT
GGTATACTTGGCAGTCTAAGTGCTAGATGCAGTGTTGTTGCTTGTGCAAACCCTGTTTCT
GGTCATTACAACCGATCAAGAACCATATTGGAGAATATCAAAGTATCAAATGCTATTCTA
TCTCGTTTTGATTTGGTATTCTTGCTTTTGGACGATCCAGATACACAGAAAGATAAGAAA
CTGAGTGAGCATGTTATGAAACTCCACTCTAGGAATAGAAAGCGCAGACTTGAGAATATC
TATGGCGGAGGTGGTGCATACTCAGAGTTGAGTGCAGGCGGCAACCCACCATTTTCTCTA
AATATAAATTCCTCAGCTGATCGCAGTGGCAATGAGTTTTCTGTTGGCGGAGGAGGAAAC
CAAGCCAAGAGATTGAAGCACAACAACTTCTACTCTCAATCATCACAAGATGATGACTAG
CCCAGACCACAACCTCTCACTCAAACTGATTTCATTAACTACACATCATTGCAGCAGAAA
ATCAAGCATTAATGTGATAGAATCAGTGATGATGACCTGCTCTCTCCTATTCTTCTAAAA
AAGTACATTTCATATGCTAAGCACACTATCTTCCCTAAACTATCACTAGAAGCATGTGAA
GTACTCAAAGATTTCTATATCACTCTGAGAGAAAATGCAAGTCAAAACAGTGCAAACTCC
CTCCCTATCACATCCAGATAATTAGACTCACTGATCAGACTGAGCCAAGCCAGAGCCAAG
ATGGAATTCAGATCGGTGGTGACCAGAGAAGATGCTCTTGACATTGTGAGATTAGTCTAA
GAATCTTTATTTGAAACTTCCTACGTTGATTTTAATCAAAAGTATGGTGGTTACAATGGC
TCCTTCTCTAGTTAGATGACATCATCAACTATGAATGGGAAGGGAAAGTCAAACTAAGTA
GATCTCTCAAACATCTCCAGTCTCTCAGTCCCCAAGCAAACCAAGCTATACGTTGATAGA
TTGAGATACGAGGCTGAGTAAAAGGGTAGCAAGTTATATGATTTCCAGGAGATGATTAAA
CTTGGAAAAGAAATGAACTTGTAAGTTGGCGATTTTAAATTATTCTTGGAGAAGTTGAAC
ATGCAAAATGTTATCATCATGAAGCCTAATAAACAGTGGGAGCTATTGTGA


>Contig7673.0.g5(protein)
MTSVNKQYYPQRSNNQVRPHHQQSDDDELNGYGGGNADQKAKTNYQTSAKLSYHNQRDNR
GGNPLSGNFDKNKLLHRWNHYFPHELVKTFDASDFKHLAIQVFFETFCQDQFQQFVTWDK
SSENYDNIIAHLNFSGLYQHCNSQLKQILEYLYEHPTELIKCVALALDSVRFLNFNHVYP
LSLIKSHLINKYICLIGTVLRVSSIKVLVESIQFQCYDCKSKILINFIDGKWENPNKCIN
MDCKGKTFVPEKHTAKTSFYQRIRIQEIDNDMRDINAGKLPKTIDCEIKDDLIDACISGD
IVTICGIMKTELQQDMKGFGAQKANKNKALHASYIDVNSIKNSNTEYFLSSAASANQTST
MSSSTENKVNMHELNEIQNLSQQRSRKGDLFALLIKSICPSIFGHELVKSGLVLSLFGGT
DYRLKNSKEFAELMYDKNGGHIEEEAEDDQGQSSSNQQNIRPDIHMLVVGDPGMGKSQML
KHLINVAPRGVYVCGNSTTNAGLTATLIRDPMTNEQNLEAGALVLSDLGVCCIDEFDKMT
SDQNTLLEAMEQQTISIAKGGILGSLSARCSVVACANPVSGHYNRSRTILENIKVSNAIL
SRFDLVFLLLDDPDTQKDKKLSEHVMKLHSRNRKRRLENIYGGGGAYSELSAGGNPPFSL
NINSSADRSGNEFSVGGGGNQAKRLKHNNFYSQSSQDDDQPRPQPLTQTDFINYTSLQQK
IKHQCDRISDDDLLSPILLKKYISYAKHTIFPKLSLEACEVLKDFYITLRENASQNSANS
LPITSRQLDSLIRLSQARAKMEFRSVVTREDALDIVRLVQESLFETSYVDFNQKYGGYNG
SFSSQMTSSTMNGKGKSNQVDLSNISSLSVPKQTKLYVDRLRYEAEQKGSKLYDFQEMIK
LGKEMNLQVGDFKLFLEKLNMQNVIIMKPNKQWELL