Identifiers and Description

Gene Model Identifier

Contig14518.0.0.g115

Standard Name

MCM3b

Aliases

Contig14518_0_0_g115

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000928509.997093137033517e-262MCM2/3/5 family protein
SGDYEL032W3.0010924337054016e-176MCM3 SGDID:S000000758, Chr V f
rom 86937-89852, Genome R...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig14518.0.0.g115(coding)
ATGGTGCAAGATTTCCTCAATCATAGAGATGTGCTCAAGCGCATCAAAGCTATCGTCGGA
AAAACTAACAGATTTAATGTCAATATGGATGACTTGAGATAATTCAAACCAGAGTTGGCA
AAGTTTGTTATTAAAGACCCCATTCAAGCAATCAAGATGTTCCAAGACCAACTCAATCAA
ACTATCAAGAATTTGGGAAAAGATTAATCGAGTAATCCAAAGGCTGCATTGCTAAACAGA
GACAATTTCCCCACTAAATCTTCGATATACTACATTAATTTCGAAGGAAACTTTGGCAAG
AATCACATCACACCTCGTGGACTCAAAGCAGATTTAGTGAATCAATTTATTGCAGTGAAC
GGCATCGTTACTAGAATGAGCATCGTGAAACCTAAAATTCAGACTAGTGTTCATTACTGT
GAGGCTACTAAGAGAGGTCTAATTAAATAGTACAATGATCAGTTCAATTTAACTCAGTTG
GCAGAAGGAGAAGGCTCAGTCACTGAACAAACAAATGCTTTTCCAACTAAAGACTAGGAC
GATAATCCACTTTCTGCTGAGTATGGCTATTGCGTCTACAAAGATTCTCAAATCATCACT
ATCCAGGAAATGCCAGAAAGAGCTCCAACTGGATAGCTTCCTCGCTCAATAAATGTCGTT
CTGGAAAATGACTTAGTTGATAAGGTCAAGCCAGGTGACAGAGTTTAAGTGACTGGAGTC
TTCAGAACAGTAGCTCCTCATAGTACTTAAAGCAGTGGAGTTTTCAGAACTTTCCTAGTT
GCTACAGGTGTGACAAGTCTAAATGCTGAGAAAGAGAAACCTAATCTTACTGACACAGAT
ATCAGAAACATCAAGAATATTGCGAAAAAAGAAAACCTCTTTGAAATTCTTGGTCATTCA
ATTGCTCCCTCGATTGAAGGCAATCTACATGTCAAGAAATCACTCTTACTTCAACTCTTG
GGTGGTGCAGAGAAGAATCTTGAAAATGGTACTCATTTGAGAGGAGACATCAATATCATG
ATGGTTGGTGACCCCTCTACTGCAAAATCCCAACTTTTGAGACATGTCATGGATATTGCT
CCACTTGCAATTAATACAACAGGTAGAGGATCGTCAGGTGTTGGTCTCACAGCAGCTGTA
ACAATCGACAAGGATACTGGTGAGAGACATCTTGAAGCTGGAGCTATGGTCTTAGCTGAC
AGAGGTATTGTCTGCATCGACGAGTTCGACAAGATGAATGACATTGATAGAGTTGCTATT
CACGAAGTTATGGAACAATAGACAGTAACTATTGCCAAAGCAGGAATTCACGTTTCTCTC
AATGCAAGATGTAGTGTGATTGCGGCAGCTAATCCAATCTATGGTGAATATGCAAGAGAT
TAACCAGTGGGAAGAAACATTGGACTGCCAGATTCGTTACTCAGTAGATTCGATTTGTTG
TTTGTTATGCTAGATGAGAAAGAAGAAGCTCATGATAGAAAGATTGCTGCTAGAGTCATC
AACAACCACAGATATCATTAAGCAAATTAAGAGAATCCACATTTCAACTATTTCAACGAA
GACTATGTGATTGAACCTGAAATGAAAGAAGATAGAAAGGACAATAGATTAGATTCTTAG
TTTGAAAAGCTTAACATCAACTTTGACAATAGAAATCCTACATAACTTTAGATTATCACA
AGAGAATTCCTCAAGAAGTACTTATCTTATGCCAAAGCATAGAAACATCCAGAACTTACA
GACGATGCAGTGACTTATGCAACTAATCTATACTCAGGCCTTCGTCACAAAGCACTTATC
TATGACCAAGGTTTAGTTGCAGTTCCCATAACTGTAAGAACTCTTGAGACAATTATCAGA
CTGTCAACTGCGCACGCCAAGATGAGGCTAAGCAAAAAGATTGAACCTATTGATGTTGAC
GTTGCTGGATATTTGTTGAACAAAACTATCTTCACAGGGGATTCAGAAACAGGTGGAAAG
ATGAAGATTGGAGAGAGTGACGACGATGATGACGATGACAATGAAGAAGTTAAAGTGGAC
AGAGTTGACAGGAAGTAAAATAGCAGAAGCAGGAGAACAATGGACAGAGAGATGAAGTCA
GAGGATTCTCCAAACAAAACTGTCAAGAGAGAAGACAAAACACCCAAGAAGTCACTTTCA
AAAAGAACTCAACCAGTGAAAGATGATCTTGACAACAGACCTTCAAAGAAAATGAAAGTA
GACGAGAATCATGTAGTAGGGTAGCTATTTCAAAGCCAAGGCAATATCTCTGTACCCGCT
GGCTCTCAATCCAATGTGAAGTATGAAACAGGAACTCATTATCAAAAATTGGTCTTTGCT
ATCATTAACAGATATAAAGACTTGAGGAATTCAATTCATTCAAAGGAAGTCTACAGCAAT
TATCAATTGATAAGAGACAATCCCAACCTTCAAATTGATCAAAATACCAAAAAGAGCTAT
TTCCCACAACCTATGCCTGAGATAAAAAATTGGGATCATATGAAGTAGATTCTGTAAGAT
CTTGAGTCTGTGGGTATGGTTATGGTAGCTGAAGATGGAGTGGTTGTTCTCATTTGA


>Contig14518.0.0.g115(protein)
MVQDFLNHRDVLKRIKAIVGKTNRFNVNMDDLRQFKPELAKFVIKDPIQAIKMFQDQLNQ
TIKNLGKDQSSNPKAALLNRDNFPTKSSIYYINFEGNFGKNHITPRGLKADLVNQFIAVN
GIVTRMSIVKPKIQTSVHYCEATKRGLIKQYNDQFNLTQLAEGEGSVTEQTNAFPTKDQD
DNPLSAEYGYCVYKDSQIITIQEMPERAPTGQLPRSINVVLENDLVDKVKPGDRVQVTGV
FRTVAPHSTQSSGVFRTFLVATGVTSLNAEKEKPNLTDTDIRNIKNIAKKENLFEILGHS
IAPSIEGNLHVKKSLLLQLLGGAEKNLENGTHLRGDINIMMVGDPSTAKSQLLRHVMDIA
PLAINTTGRGSSGVGLTAAVTIDKDTGERHLEAGAMVLADRGIVCIDEFDKMNDIDRVAI
HEVMEQQTVTIAKAGIHVSLNARCSVIAAANPIYGEYARDQPVGRNIGLPDSLLSRFDLL
FVMLDEKEEAHDRKIAARVINNHRYHQANQENPHFNYFNEDYVIEPEMKEDRKDNRLDSQ
FEKLNINFDNRNPTQLQIITREFLKKYLSYAKAQKHPELTDDAVTYATNLYSGLRHKALI
YDQGLVAVPITVRTLETIIRLSTAHAKMRLSKKIEPIDVDVAGYLLNKTIFTGDSETGGK
MKIGESDDDDDDDNEEVKVDRVDRKQNSRSRRTMDREMKSEDSPNKTVKREDKTPKKSLS
KRTQPVKDDLDNRPSKKMKVDENHVVGQLFQSQGNISVPAGSQSNVKYETGTHYQKLVFA
IINRYKDLRNSIHSKEVYSNYQLIRDNPNLQIDQNTKKSYFPQPMPEIKNWDHMKQILQD
LESVGMVMVAEDGVVVLI