Identifiers and Description

Gene Model Identifier

Contig9327.0.0.g58

Standard Name

MARS2

Aliases

Contig9327_0_0_g58

Description

tRNA synthetases class I (M)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam01406 ) tRNA synthetases class I (C) catalytic domain
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam01921 ) tRNA synthetases class I (K)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006918109.999776257620412e-83methionyl-tRNA synthetase
SGDYGR171C2.0001503375893664e-79MSM1 SGDID:S000003403, Chr VII
from 842551-840824, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9327.0.0.g58(coding)
ATGGGGGAAGAAGTTTTGTTTTCAACAGGTACGGACGAGCACGGTCTAAAGATTCAAAAG
AAGGCGAATGAGGCAGGCATTGATGCCTTGAAGTTCTGTGATAAAAACTCAGAATAGTTT
AGAAAACTCTTTGAACAGGCCAGTATTTCATATGATAGGTTTATTAGGACTACAGACAGT
AAGTATTAATAAAGCATTTACAATTTAATAGATGACCACAAAGTAGCAGTGCTGGACTTT
TGGAATAGACTAGTAGATAGAGGTTATATCATAGAAGGCAAGCACGAGGGTTATTACTCA
GTGAACGAAGAGTCATTTATCTCAGAAAAAGATCTGGCTAGGGATGAAAAAGGGAATTAT
TTCACTTTATTAGATGAAAGTGTAGAATTAATCTAAGAAAGGAATTTCGTTTTTGATATC
GATTTGAGGCTGAGAATTCAAATCAAATAATGGCTCAATAGTGGCGCAGTTGAACCAGAG
CATATTAAAGAGAAGTTATTAGATGATATGAATATGCGAAAAAGTGAGATATCAGTGAGC
AGGCCTACAAGTAGGATAGCTTGGGGTATTAAAGTGCCAAATGATAGCTCTTAAACTATT
TATGTGTGGCTTGATGCATTAGTTAATTATCTCACTGTTATTGGTTATCCAAACTAAATG
AGATAAAATGGAGCAGAAATTGGAGAACTTATCCATGTAATAGGAAAAGACATAGCTAAA
TTTCATTGTATTTATTGGCCTGCTTTCTTAAGAGCAGATGATTTACCTTTCCCTAAAAGA
GTTATTTGCCATGGTCACTGGCTTTAAAATAAAATGAAAATGTCTAAGTCTCTCGGTAAC
GTAGTTGACCCTTTCGATTTGATTAAAACCTTTGGAATAAATTCAGTAAGAAGTTACTTC
TTAAGTTAAGGCCCATAATTTAAAGACAGCGATTTCCAAATGGATTAATTAACAATTCAT
CATAATGGCGTTGTCTGTGATTAATACATGAATCTACTATAAAGAATAACAGGCAAGAAA
ATTTGGAAAAATAGGACAGTTCTAGAGCCAATGAATGAAAAACAAATAGAGATGATTGGA
TTAGAGACTAAAGATCAAATAAACTTATTAGCAGAAGATTGTTTAAATCTCATGAAAAGT
TATGAATTTACCCTAGCTTTCAAGAAGATTGAGGAAATACTCTATATCGGCAACTTTATC
CTTGCCAATAATAAATTCTGGGCAATTAAAGATGAGAAAGAACTCGATGCTTTACTATAT
ACAACCATGGAAATTCTTAAAGTGACATCGATATTACTCCAGCCCTACTGCCCTGACCTA
TCAAAGAACATGCTAGATTTCCTACAAATTAAAGAGAGATTCTTAGATTAGGCAACATTC
GTATTTGATAGGAGGATTACATTCGACAATAAAGCCAGAGAGAAATTATTCATTCCTAAA
ATTGAACAAAAATAGGCTGATACGAAATAGTGA


>Contig9327.0.0.g58(protein)
MGEEVLFSTGTDEHGLKIQKKANEAGIDALKFCDKNSEQFRKLFEQASISYDRFIRTTDS
KYQQSIYNLIDDHKVAVLDFWNRLVDRGYIIEGKHEGYYSVNEESFISEKDLARDEKGNY
FTLLDESVELIQERNFVFDIDLRLRIQIKQWLNSGAVEPEHIKEKLLDDMNMRKSEISVS
RPTSRIAWGIKVPNDSSQTIYVWLDALVNYLTVIGYPNQMRQNGAEIGELIHVIGKDIAK
FHCIYWPAFLRADDLPFPKRVICHGHWLQNKMKMSKSLGNVVDPFDLIKTFGINSVRSYF
LSQGPQFKDSDFQMDQLTIHHNGVVCDQYMNLLQRITGKKIWKNRTVLEPMNEKQIEMIG
LETKDQINLLAEDCLNLMKSYEFTLAFKKIEEILYIGNFILANNKFWAIKDEKELDALLY
TTMEILKVTSILLQPYCPDLSKNMLDFLQIKERFLDQATFVFDRRITFDNKAREKLFIPK
IEQKQADTKQ