Identifiers and Description

Gene Model Identifier

Contig4668.0.g1

Standard Name

MARS1b

Aliases

Contig4668_0_g1

Description

tRNA synthetases class I (M)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam09334 ) tRNA synthetases class I (M)
  • ( pfam00133 ) tRNA synthetases class I (I, L, M and V)
  • ( pfam08264 ) Anticodon-binding domain of tRNA
  • ( pfam00130 ) Phorbol esters/diacylglycerol binding domain (C1 domain)
  • ( pfam12773 ) Double zinc ribbon

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_011450109.997093137033517e-262methionyl-tRNA synthetase
SGDYGR264C9.997093137033517e-262MES1 SGDID:S000003496, Chr VII
from 1021853-1019598, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4668.0.g1(coding)
ATGTAGAAGAAAGATACTCAACAACCAACTAAAGCTAAGATCAGTTATACCAACCCAGAT
CTCTCAGCTTTCCTCATTGAAAACTTGGTTAAGGCTCTTGGAGTTCAAGTTCCCATTAAA
AAGATCGGTACAGCAGACTTGTCAGCTAAGAGTGATATCACTAATGTAAAGCTACAAATT
GAAGGAGGTTCCACCCTATTCGGAGAAATGGCAATTGCTGACTTCTTAATCGGAGAAAGA
AACAAAACTCTTTCTTAAGCTGAGGTTGCCAGTGGGTAGACAGCCCTCAGATTTGGCAAA
GACCTTGCATTTGACCACTGGGTCTACTGGCTTAATACCAACTTGAGAGAAGCAGTACAT
TCTTTCTAAATTGGTAAAGAGGCTGACAAGAAAGAAATCTTGAAGAAATTAGTCAAGGAA
GTCGATGAAAAGGTCTACCCAGAAGTATTCGTAAATGGTGGAAGATTCAACAATCAACAA
GGCCTCCTTCTCTAAATTATGTTCTATTCATACCTTCAACCTGTCTAGCAAATGGTCAAT
AACATCTTCAAGCAGCTCTTGCCAAAAATTAGAGATCAGTTTGGACTTTAAACTTTTGAG
GCATTTAGAGGTGGAGACCAACCTGCTGCAGGAAAGAAGGGTGTCCAAAAGGATATCACA
GTCTCACAATCAAGTGCTAAGATTAAGAGAGTCAATTTCCATAGAAATCTCGTTCCTTAA
AAGGATAAGCGTAATGTGTTGATCACATCAGCACTTCCTTATGTAAACAACGTGCCTCAC
TTGGGTAATATCATCGGATGCGTCCTATCAGCTGATGTCTTTGCAAGATATAGCAGATTA
ATGGGTTACAATACTTTGTACATTTGCGGAACAGACGAGTATGGTACTGCTACAGAGACT
AAAGCTCTAGAGGAGAAGAAAACTCCCAAGGAAATTTGTGATCACTATCATGAAATTCAT
AAAGGCATTTATGAATGGTTTGATTGTGACTTTGATCATTTTGGTCGTACTACAACTGAC
TTACAGACAGAAATTACCCAAGATATCTTCAAAAAGCTTCATGATAACAACTTTACCTAC
GAATAAGTTGTTGATCAATAGTTCTGTACAGCATGCGATAGATTCTTGGCTGATAGATTT
GTTGCTGGAACTTGCCCACTTTGTAATTTTTATGATGCCAAGGGTGATTAATGCGATGGT
TGCGGAAAATTGATTAATGCTAATGAACTTATCAACCCCAAATGTAAAATATGCGGAGCA
ACTCCAGAAATCAGATAATCAACTCATATCTTTATTGACTTGCCAAAAATTCAACCACTT
CATGAAGAATGGTTTGATGGTGCTTCAGTAAAAGGTAAATGGGCTTAAAACGCAATTCAA
TTTACAAATGCTCTTTTGAAAGAAGGTCTTAAGGGAAGATGTATCACTAGAGACTTGAAA
TGGGGAACTCCTGTACCACTTGAATCATACTCTCACAAAGTTTTCTACGTTTGGTTTGAT
GCTCCTATTGGATATCTTTCAATCACTGCAAACTATAATGCTGAAAACTGGAAAAAGTGG
TGGATCAACAACGACAACGTTGAACTTTATCAATTTATGGGAAAAGATAACATTACTTTC
CATTCAGTCATATTCCCTTGCTCTCTTCTAGGAACTAAAGAGCCATATACTATGTTACAT
CATATTGCTACTACAGAGTTCTTGAATTACGAAGTTGATGAGAAAACTGGCAAGCCAAAG
AAGTTCTCAAAGACCAGAAAGACTGGTGTCTTCGGTGATGATGCTATTAAGACTGGTATT
CCTAGTGAAGTATGGAGATATTACTTGCTTATTAACAGACCTGAGCAGTAAGATACTATT
TTCTTGTGGAGTGATTTCATGGCTAAGAATAACAACGAACTACTAGCAAATCTTGGTAAC
TTTTCTAACAGAATCCTGAAGTTTGTTGCTTCAGCTTATGAAAAGAAAGTTCCAGCTTAT
CCAGGCGAAACTAACGCTGAAGATTTAGCTTTCATTCAAAGCCTCTATCATGAATTCGAA
ACTTATATTGAGCTTATGGAAGGATGCAAACTTAAAGACTCTTTGAGAACAGCTATGCAT
ATCTCTCACTTATGCAATGTCTACATGCAAAACACCAAACCTTGGGATCTTAAGAAATAA
AATCTAGCTGACAGATGCAACCAAGTTGTAAATACTGCCCTAAATGCCCTTAGATTCTTA
TCTGTAATATTTGAGCCATTCATGCCAAGCTTTTCAGCCAAGGTCAACGAGCAGCTTGGT
CTTCAAAGGACTGAATAGGATGAAGTTTTGCTTGAATATATCAACGGACATCCAGAGAGA
ATTTTACATCTCATCAAGCCAGATCATGTCCTTGCTGAGCCACAACCAATCTTTAGAGAA
ATTAAGCAAGAAGAAATTGAAAAATGGAAGAAAGACTTTGGTGGAAACAATTGA


>Contig4668.0.g1(protein)
MQKKDTQQPTKAKISYTNPDLSAFLIENLVKALGVQVPIKKIGTADLSAKSDITNVKLQI
EGGSTLFGEMAIADFLIGERNKTLSQAEVASGQTALRFGKDLAFDHWVYWLNTNLREAVH
SFQIGKEADKKEILKKLVKEVDEKVYPEVFVNGGRFNNQQGLLLQIMFYSYLQPVQQMVN
NIFKQLLPKIRDQFGLQTFEAFRGGDQPAAGKKGVQKDITVSQSSAKIKRVNFHRNLVPQ
KDKRNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRLMGYNTLYICGTDEYGTATET
KALEEKKTPKEICDHYHEIHKGIYEWFDCDFDHFGRTTTDLQTEITQDIFKKLHDNNFTY
EQVVDQQFCTACDRFLADRFVAGTCPLCNFYDAKGDQCDGCGKLINANELINPKCKICGA
TPEIRQSTHIFIDLPKIQPLHEEWFDGASVKGKWAQNAIQFTNALLKEGLKGRCITRDLK
WGTPVPLESYSHKVFYVWFDAPIGYLSITANYNAENWKKWWINNDNVELYQFMGKDNITF
HSVIFPCSLLGTKEPYTMLHHIATTEFLNYEVDEKTGKPKKFSKTRKTGVFGDDAIKTGI
PSEVWRYYLLINRPEQQDTIFLWSDFMAKNNNELLANLGNFSNRILKFVASAYEKKVPAY
PGETNAEDLAFIQSLYHEFETYIELMEGCKLKDSLRTAMHISHLCNVYMQNTKPWDLKKQ
NLADRCNQVVNTALNALRFLSVIFEPFMPSFSAKVNEQLGLQRTEQDEVLLEYINGHPER
ILHLIKPDHVLAEPQPIFREIKQEEIEKWKKDFGGNN