Identifiers and Description

Gene Model Identifier

Contig8335.0.g40

Standard Name

MARCAL1b

Aliases

Contig8335_0_g40

Description

SNF2 family N-terminal domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_006271502.9990203769197855e-115SNF2 family N-terminal domain
containing protein
SGDYPL082C1.9993430003514377e-39MOT1 SGDID:S000006003, Chr XVI
from 404083-398480, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8335.0.g40(coding)
ATGCATCCAAATTACTGGACAGTTTTAACTAGTAAACTACTCAGTTACCACTAAGGGAGA
ATTGCAAATGCGAAGAATTTGACTTATGGGCAGTAAAAAGATCTAATTGAGAAGTTGAGT
GATCCAAATAATCACGATTTTGATGAAGAGCTTGCAGAGGGGACTCCAAGGACAAGAGAG
AAATTCGCTGGGCTGATTTCAGACACAGTGTGGAAAAACAACCCAAATTCTGATTACAAC
AAGTAAAACAACAAATACCCTCAGATGAGTAGAGAAGCTTACGAGGATCAAAGATAGTAC
TTTTTACATAGGAAAAATCTTGCTGAAAACATCGAAAAAGCTAGACGAGCTGATGATAAC
AAAATTAAGGAAAAGGAGTTAGCAGATAAAAGAGAGAAAGAGGCCTAAGCATTGAGAGCT
GCTAACAAGAAAAAGTACATGGAAAAAAAGAAGTCCATTAAAATGCAGTAGATGCTCTAA
AATTAAGAAGATGAAGAAGGTGATATATAGCTTAGAGATGGGAGGACAAGAGTCGTCAAT
GTTTAAATGATTTCTTAAGAGATGTTTTCTGTTAGCACTAACTTTGTGATGCCTGAGGAG
ATCGAATTTGCAGTCGAATGTTTAAAATACTGTTAAGCTAGGAAAATATGCGTTGATCTA
ATACCTCAAATGGTATTTGATCTTTTTGAGTTCAAAGTACCATTCTCTGATACTTCTAAG
ATTTCGATTGTGAACTATGATTATCATGAAGATTTCGATCATAAAGCAAATATTTAAAAC
CTTCCAAAGTCCCTATATGCTTAACTTTATCACTTTTAAAGAGTTGGAGTTTAGTTTGGT
ATAGATCATCACGGTAGATGCTTAATTGGTGATGAAATGGGAGTGGGAAAAACTATTTAG
GCCATCTCGATTAGCTACTTATATAAAAAGGACTGGCCTCTTCTTATAATAACGCCAAGT
TCTTTGAGATTTACATGGAGAGATGAGCTTATGAACTGGCTAGGTTTTATCAAAGAAGAA
GATATTTAAGTCCTAACATCTTCTTAAGATTGCTTCAGTAGTACTTGTTAAATATATATA
ATAAGCTACAACATTGCAACAAGACTGGCTGGACTTATTGATAGAAAAAAATTTGGAATG
ACTATAGTAGATGAAGCTCATTATTTAAAGAGCAGAGATAGTAAGAGAGCAAGAAATTTA
GTCCCAGTACTTATGAAGATGAAGAGGATTTTACTGCTTTCTGGTACACCAATTTTAGCC
AGACCTAACGAAATTTACAATTTAACAAGAATCTTGAGACCAGATATTTTCTACTCTTTC
AAAGAATTTGGACTAAGATATTGTAACCCTAAGGAGAGTTACTTTGGCATAGATTGGACT
GGAGCTGCAAATAATAGAGAGCTTTATTAAACTCTTAAAAACTCATTTATGATAAGAAGA
ATGAAACAAGAAGTATTAACTGAACTTCCAGCTAAAAGACGTCAAAGAATAAGCATATCA
ACAGATAGTAACTAAGTTAAGAAAATTCATTATATGTTAAAGAAAGTGAAAAATTGGCAA
GATAAGATAGGACGAAAGGGAGAAAATGCATTTGGAGATTTAACTGATGATTTCGACGGT
TTTGTATAGCAACATGGAGATAACATGATGGCAGATCCTACTTTCAGTTCTCTTGATGAC
AAGTACTCTTACTTAGTGAATGCTTATGGACTTACAGGCACAGCTAAAATTAAAGGTATT
TAAGAGTTTATAGAAACTTTACTTGAAAACAGATGCAAATTTTTAATATTTGCTCATCAC
TACGATGTTCTAGATGCAATCGAAGATACTGTTATAAAGAAGAAGGTATCACATATTAGA
ATTGACGGTAAAATTGATGTCACTAAAAGATATGAAGCAGTCAGAAAGTTTCAAACTGAT
TCAGAGTGTCTTGTAGCTGTACTTTCACTAACTGCCTCTTGTACAGGTATAACTTTAACT
GCAGCTTCGACTGTTGTTTTTGCAGAAATGAATTGGACGCCTGGTATTATGGTTTAAGCT
GAAGATAGAGCTCATCGTATAGGCCAAATTAACTCAGTGAATGTATACTATTTATTTGGA
GAAAATACCCTGGATGCTATGATATACCCAAGACTTAAACTTAAATCCGAAGTTTTCGCA
AACGTAGTAGATGGCAAAGGCACAGACTTCAGAATTGACAATGAAGACGAAGCACGAGAG
TACATCAATAAATAGATTTAAGACAAGAAAAACAATGGTAAACTTCAATTGAAGTTTGAA
AAGATAAGCAACTCAACGAATCAATCTCAGCTTGACATGCAGCAATCAAATATCTCTGAC
TTCTTTTTTGTTAAAAATAAGGTATCTTCTAAGATCAAGCACGATTTTTCTTCAAACTAG
AGCAATTTTAATGAAGACTCGGTTTTAGCTGTAGACCCTAATGATAGCTCTTCACTAAGC
TTAAAAAACGCTGGCCCAGAGAAAATAATGAGACTTATAGAAAAATAAAATCATAGAAAT
TCATCAAATTAAAACGATGTAGATCTGAGTGATTAAGATCGATATAAAAATAAATTTGAA
GAGAGTATGAGCGAAGATGAGGAACTTGGAGAATATATGCTTAAGAAATCTAAATTAGTC
TAGCAACAAGTTCCCATCAAAGATTATTAACATCCTGATAATTAGGAATTTTACATGCCA
GAACCACCATTAGCTAGTAGTTCCTCACTATATGATCAAAACAATGGTAGAATCAATATC
TTTGATGAAGATTGGGATGAAGGCACTGATACTAAACAGAAAGCCTATTAAAAACTAAGA
GCAGACAAGAATAAGATGTTTGAAGAGAACAAAATTTTCAAGAAATTCACAAGTCAATTT
AAAGGACTGAAACGTATACATTAGAGAGCTAAGAAACCTAATAAAATAACTGAGTATGAA
CTGCCAAGAGATCCAGGCAAAACAAACAGAAAAATTTAAGATTTCGATCCTGGCATGCTA
CTTGAAATGGAGTTTCAGTTTGATGAAGAAAGGAAAATTAAATAAGAAGAGAAACTCTAT
GGAAAACGTAAGAGCAAAAATGAGCCTGATGAAGTCGAGATCGTAAAAGTAACTCACCTA
AATAAAGAGGATAAAGAAAATCGTGTTTTGAGCATACGGGAAGAGCTAATGAGTGAAGAT
AACACTTAAGTCTAAACCTGGAGACAGATGATGATTAAAAAAGAGGACACTTAAACTACT
TCTTTGACTTAAGCACTTACTTTTTAGTAGTCTACAGCACCAAATAATTCAACTTCTTTT
ACTCAATAAACACCTCTGACACTTGGCTTGAATCAAAACTAAGGCTCCTCAAATTTAAAT
TCTACTTTGACCACATAAAGTAGACCTCCATAGACTCAATAAAAACTGCTTAATGGTGGC
TGCACAATAGCCAGTAACCATCTGGATAAGTGGGGTTACTACGAAACGATAAGCAAATTT
CAAAATGAAAGCGATGTGAAGCGAGAAATAGAGAGGAAAAAGTACACTGAAATGCTCAGG
AACATGCAATTATACGATAATTGCAAGATTAAAGGGCTTTTGCAAAGTGAAATAGTACAG
ATGAGGGAATTAAATATAACAGATGATGAGGATATGGAATATAATAAAATATAAGAAATG
AAGTGA


>Contig8335.0.g40(protein)
MHPNYWTVLTSKLLSYHQGRIANAKNLTYGQQKDLIEKLSDPNNHDFDEELAEGTPRTRE
KFAGLISDTVWKNNPNSDYNKQNNKYPQMSREAYEDQRQYFLHRKNLAENIEKARRADDN
KIKEKELADKREKEAQALRAANKKKYMEKKKSIKMQQMLQNQEDEEGDIQLRDGRTRVVN
VQMISQEMFSVSTNFVMPEEIEFAVECLKYCQARKICVDLIPQMVFDLFEFKVPFSDTSK
ISIVNYDYHEDFDHKANIQNLPKSLYAQLYHFQRVGVQFGIDHHGRCLIGDEMGVGKTIQ
AISISYLYKKDWPLLIITPSSLRFTWRDELMNWLGFIKEEDIQVLTSSQDCFSSTCQIYI
ISYNIATRLAGLIDRKKFGMTIVDEAHYLKSRDSKRARNLVPVLMKMKRILLLSGTPILA
RPNEIYNLTRILRPDIFYSFKEFGLRYCNPKESYFGIDWTGAANNRELYQTLKNSFMIRR
MKQEVLTELPAKRRQRISISTDSNQVKKIHYMLKKVKNWQDKIGRKGENAFGDLTDDFDG
FVQQHGDNMMADPTFSSLDDKYSYLVNAYGLTGTAKIKGIQEFIETLLENRCKFLIFAHH
YDVLDAIEDTVIKKKVSHIRIDGKIDVTKRYEAVRKFQTDSECLVAVLSLTASCTGITLT
AASTVVFAEMNWTPGIMVQAEDRAHRIGQINSVNVYYLFGENTLDAMIYPRLKLKSEVFA
NVVDGKGTDFRIDNEDEAREYINKQIQDKKNNGKLQLKFEKISNSTNQSQLDMQQSNISD
FFFVKNKVSSKIKHDFSSNQSNFNEDSVLAVDPNDSSSLSLKNAGPEKIMRLIEKQNHRN
SSNQNDVDLSDQDRYKNKFEESMSEDEELGEYMLKKSKLVQQQVPIKDYQHPDNQEFYMP
EPPLASSSSLYDQNNGRINIFDEDWDEGTDTKQKAYQKLRADKNKMFEENKIFKKFTSQF
KGLKRIHQRAKKPNKITEYELPRDPGKTNRKIQDFDPGMLLEMEFQFDEERKIKQEEKLY
GKRKSKNEPDEVEIVKVTHLNKEDKENRVLSIREELMSEDNTQVQTWRQMMIKKEDTQTT
SLTQALTFQQSTAPNNSTSFTQQTPLTLGLNQNQGSSNLNSTLTTQSRPPQTQQKLLNGG
CTIASNHLDKWGYYETISKFQNESDVKREIERKKYTEMLRNMQLYDNCKIKGLLQSEIVQ
MRELNITDDEDMEYNKIQEMK