Identifiers and Description

Gene Model Identifier

Contig11345.0.g55

Standard Name

MAK16

Aliases

Contig11345_0_g55

Description

Ribosomal L28e protein family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam01778 ) Ribosomal L28e protein family
  • ( pfam04874 ) Mak16 protein C-terminal region
  • ( pfam03115 ) Astrovirus capsid protein precursor

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000474605.000412888119721e-59Mak16 protein
SGDYAL025C5.0007856079333316e-54MAK16 SGDID:S000000023, Chr I
from 101145-100225, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11345.0.g55(coding)
ATGACCTACCTAGTATTTATTTAATGGGATGGAATTTTGGAAAATGCTATAGATCTACTT
GAACTAGATTCTTTTGCTATATTTGCCCCAACAGTGACTTAAGCCTTCTGCAGAAATGAG
TATAATTTGACAGGTCTCTGCAACAGACATTCTTGCCCATTGTCTAATTCTCGCTATGCC
ACTGTCCTTGAACACAAGGGACATTGCTTCCTCTACATGAAAACAATTGAAAGAGCACAT
TTGCCAAGTAAACTTTGGGAGAAAGTGAGACTACCTAAGAACTATCAAAAGGCACTAGAA
ATGCTCGATGATAATTTGGAATTTTGGGGAAAGTTCCAGAGACACAAATGCAAGTAGAGA
CTCACCAAGCTCCATTAAATGATCATCAGACAAAGAAAACTCCGTATTAGTTCCATGCAC
ACCCAGGAAAAGTTAGTAGTAATAAACAAGAAATACGAGAAACGTGAAGCCAACAGAGAA
AAAGCCGCTGAAAAAGCAGCTATGGTTGATAGAGCCATCGAGAAGGAGCTAGTGCAAAGA
CTGAAAAGCGGCACCTTCTATCCCCAGGAGATATACAACTTGAATTAAGAGGAATTCAAG
GAGGTACTTGACAAGAACGAAGTCACTGAGTACGAAATCGATGTTGAAGAAGAGGAAGAA
GAAGAGAACGAAGAGGAGTATGAGTATGACAGTGAGTTGGATGAAGACGAGCTTAGGATG
CTTGAAGATGAAGAAGAGAATGATGAAGACCTTGAGGACATGGGTGAATTCTTAGATGGT
GAATAGGGAGGTAAATCAGGTAAATCAAGCGATAAATAAGCCGGACAAAAGCGACCCAGA
GTGAGAATAAATTACGAAGATGAGGACGAAGACAATTTGGAGTATGAATACGAAGATGAA
ACAATCACAAAGAAGAAGGACCTCATTAAAGCTAGTGTAGCAGGAGGTAGTGGAAAAAAT
CAAGCAAATAAGAGATAGAAGACTGGCAAAGTTGGAGGATCGTCTGGAGGAGGCGTTGAT
TTTTGA


>Contig11345.0.g55(protein)
MTYLVFIQWDGILENAIDLLELDSFAIFAPTVTQAFCRNEYNLTGLCNRHSCPLSNSRYA
TVLEHKGHCFLYMKTIERAHLPSKLWEKVRLPKNYQKALEMLDDNLEFWGKFQRHKCKQR
LTKLHQMIIRQRKLRISSMHTQEKLVVINKKYEKREANREKAAEKAAMVDRAIEKELVQR
LKSGTFYPQEIYNLNQEEFKEVLDKNEVTEYEIDVEEEEEEENEEEYEYDSELDEDELRM
LEDEEENDEDLEDMGEFLDGEQGGKSGKSSDKQAGQKRPRVRINYEDEDEDNLEYEYEDE
TITKKKDLIKASVAGGSGKNQANKRQKTGKVGGSSGGGVDF