Identifiers and Description

Gene Model Identifier

Contig21359.0.g62

Standard Name

MAGO1b

Aliases

Contig21359_0_g62

Description

Mago nashi protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004766907.997481627602355e-72Mago nashi protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21359.0.g62(coding)
ATGGAAACAGAAAAAAAGCAATCTGTAGCTGAAGGAGAAGACGACTTTTATCTCAGATAC
TACGTGGGCCACAAGGGTAAATTCGGGCATGAGTTCTTGGAGTTTGAGTTCAGACCTAAT
GGAAGAATGCGCTACGCTAATAATTCGCAATATAAATCAGAGACACTCATTAGAAAGGAA
GTTTATGTAAACGATATTGTTCTTGACGAGCTGAAGAGAATAATCAAGGATTCAGAAATT
ATAAAGGAAGATGATAGAAACTGGCCAGAGCCAGATAAAATTGGCAGATAAGAACTCGAG
ATTTTAATTGGCAGCGAGCACATCTCCTTTACTACATCAAAATTGGGCTCATTTTCAGAT
GTAAAGAACAGCAAAGATCCAGATGGCTTGACTGTGTTTCACTATTTGATCCAGGATCTC
AAGTGCTTCGTATTTTCAATTATTAGTCTTCATTTCAGAATCAAACCAGTGCAGAACTGA


>Contig21359.0.g62(protein)
METEKKQSVAEGEDDFYLRYYVGHKGKFGHEFLEFEFRPNGRMRYANNSQYKSETLIRKE
VYVNDIVLDELKRIIKDSEIIKEDDRNWPEPDKIGRQELEILIGSEHISFTTSKLGSFSD
VKNSKDPDGLTVFHYLIQDLKCFVFSIISLHFRIKPVQN