Identifiers and Description

Gene Model Identifier

Contig16952.0.g27

Standard Name

MAGO1a

Aliases

Contig16952_0_g27

Description

Mago nashi protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004766907.997481627602355e-72Mago nashi protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16952.0.g27(coding)
ATGGAAACAGAAAAAAAGCAATCTGTAGCAGAAGGAGAAGACGACTTTTATCTCAGATAC
TACGTGGGCCACAAGGGTAAATTCGGGCATGAGTTCTTGGAGTTTGAGTTCAGACCTAAT
GGAAGAATGCGCTACGCTAATAATTCGCAATATAAGTCAGAGACACTCATTAGAAAGGAA
GTTTATGTAAACGATATTGTACTTGACGAGTTGAAGAGAATAATTAAGGATTCAGAAATT
ATAAAGGAAGATGATAGAAACTGGCCAGAGCCAGATAAAATTGGCAGGCAAGAACTCGAG
ATTTTAATCGGCAGCGAGCACATCTCCTTCACTACATCAAAACTAGGCTCATTTTCAGAT
GTAAAGAACAGCAAGGACCCAGATGGCTTGACTGTATTTCACTATTTGATCTAGGATCTT
AAATGCTTCGTATTTTCAATTATTAGTCTTCATTTCAGAATCAAACCAGTGCAGAACTGA


>Contig16952.0.g27(protein)
METEKKQSVAEGEDDFYLRYYVGHKGKFGHEFLEFEFRPNGRMRYANNSQYKSETLIRKE
VYVNDIVLDELKRIIKDSEIIKEDDRNWPEPDKIGRQELEILIGSEHISFTTSKLGSFSD
VKNSKDPDGLTVFHYLIQDLKCFVFSIISLHFRIKPVQN