Identifiers and Description

Gene Model Identifier

Contig4510.0.g47

Standard Name

LUC7L2b

Aliases

Contig4510_0_g47

Description

LUC7 N_terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005578402.999758165421992e-18hypothetical protein
SGDYDL087C0.00000000009998509410508463LUC7 SGDID:S000002245, Chr IV
from 300999-300214, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4510.0.g47(coding)
ATGGATCATATTCGCTAGGACTTAGATGAATTGATGGGGAAGGATAGAAACCATCCTTTG
CATGTCAGACTACAAAAAAGAGATCACTTTGACGACGATTATGTTTGCAAATACAATTTG
CTTTCTTTTTGCCCTCACGACTTGTTTCCCAACACAAAAGCAGATATTGGACCATGCTAG
AAGCGCCATGACGACTATTTGAAGGAGATGTTCAAGAATGACCCTGATAGAGAGATATAT
CAGAGAAAGTACGAAAAAGAACTACAAAGTTTGTTGGAGCAGATGATTGCATAAGTTGAT
TAAAAAATGAAGAGATCCATAGCTAGAGTTGAAAATCCTGGACCTGATCATATCAACTAA
CCAGAAATTAATGCCAGTTAACAGGAAAGTTTGAACTAGAAAATTGATTAACTTGAGCAA
AAAATCAACTTTTATATTGAGAGAGCTGAGAAACTTGGAGAAGAGGGGTAGATTGACGAG
AGTGAGGCTATTATGAAAGTGGTTGATGATTTGAAAAAGCAGAAGACAGAACTTGAATCC
TTAACTGACGTAAATATGATCCCAAAAGATAAAAACATGAAAGTTTGCCCAGTCTGTGGT
GCACTGTAAGCCTCAACTGACACTGACAGAGACTTTAAATGCATCAGGAAGCAAAAGCGT
GAGGAATACCGAAGACTTAACGAAAGATAAGGTAAGAGAAGATCCAGATCAAGATCTGTC
TCACCAACTAAGGTTGCACTTCCTAGAAGAAACATTCATGGGCACAATCCTTAAGCTGAT
GATAAAGTTAATGAAGCTTTTTATTTCAGCTCTAAGAAGTATGGCTCTGGCGTCAATGTG
CCAGACTCAAATATAAGGTTCACTGAACTAGCAATTGAAAATAATAAAGGAGTTAATGTG
CAACTGGCAAAGACTGAGACCATGGCAAAAGAGTGGGGTTACTATAAAAGAGCAATAGAT
AAGAAGCGTAGAGAACAATAAAATAAGGAGAAAGCTGAGAAGAGAGACGAAGAAAGAGGA
GGAGGCTACAAGAGATTTGATGATGGTGGCAGAGGAGGAAGAGATGGCGGTGATAGGAGA
AACGATCGTGAAAACTTCTCAAGACCTCCAGGCGGTGGCTACGGTGGCGGAGATAGAAAT
AGAGACGGTGGAAGATAAGATGATAGAAGAGGTGGCGGCCAATATAATGGCGGTGGCAGA
GATAACTATAGAAGCGGCGGTTTTGCTGGTGATTAGAGAAGAAGATGA


>Contig4510.0.g47(protein)
MDHIRQDLDELMGKDRNHPLHVRLQKRDHFDDDYVCKYNLLSFCPHDLFPNTKADIGPCQ
KRHDDYLKEMFKNDPDREIYQRKYEKELQSLLEQMIAQVDQKMKRSIARVENPGPDHINQ
PEINASQQESLNQKIDQLEQKINFYIERAEKLGEEGQIDESEAIMKVVDDLKKQKTELES
LTDVNMIPKDKNMKVCPVCGALQASTDTDRDFKCIRKQKREEYRRLNERQGKRRSRSRSV
SPTKVALPRRNIHGHNPQADDKVNEAFYFSSKKYGSGVNVPDSNIRFTELAIENNKGVNV
QLAKTETMAKEWGYYKRAIDKKRREQQNKEKAEKRDEERGGGYKRFDDGGRGGRDGGDRR
NDRENFSRPPGGGYGGGDRNRDGGRQDDRRGGGQYNGGGRDNYRSGGFAGDQRRR