Identifiers and Description

Gene Model Identifier

Contig424.1.g115

Standard Name

LUC7L2a

Aliases

Contig424_1_g115

Description

LUC7 N_terminus

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005578403.0010664139725277e-29hypothetical protein
SGDYDL087C6.001122775063233e-17LUC7 SGDID:S000002245, Chr IV
from 300999-300214, Genom...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig424.1.g115(coding)
ATGGATCATATTCGCTAGGACTTAGATGAATTGATGGGGAAGGATAGAAACCATCCTTTG
CATGTCAGACTACAAAAAAGAGATCACTTTGACGACGATTATGTTTGCAAATACAATTTG
CTTTCTTTTTGCCCTCACGACTTGTTTCCCAACACAAAAGCAGATATTGGACCATGCTAG
AAGCGCCATGACGACTATTTGAAGGAGATGTTCAAGAATGACCCTGATAGAGAGATATAT
CAGAGAAAGTACGAAAAAGAACTACAAAGTTTGTTGGAGCAGATGATTGCATAAGTTGAT
TAAAAAATGAAGAGATCCATAGCTAGAGTTGAAAATCCTGGACCTGATCATATCAACTAA
CCAGAAATTAATGCCAGTTAACAGGAAAGTTTGAACTAGAAAATTGATTAACTTGAGCAA
AAAATCAACTTTTATATTGAGAGAGCTGAGAAACTTGGAGAAGAGGGGTAGATTGACGAG
AGTGAGGCTATTATGAAAGTGGTTGATGATTTGAAAAAGCAGAAGACAGAACTTGAATCC
TTAACTGACGTAAATATGATCCCAAAAGATAAAAACATGAAAGTTTGCCCAGTCTGTGGT
GCACTGTAAGCCTCAACTGACACTGACAAGAGACTTTAAATGCATCAGGAAGGTAAATTG
CATACTGGCTACTAGAAAATCAGAAAAGTGCTTGCTGAATTGAAGCAAAAGCGTGAGGAA
TACCGAAGACTTAACGAAAGATAAGGTAAGAGAAGATCCAGATCAAGATCTGTCTCACCA
ACTAAGGTTGCACTTCCTAGAAGAAACATTCATGGGCACAATCCTTAAGCTGATGATAAA
GTTAATGAAGCTTTTTATTTCAGCTCTAAGAAGTATGGCTCTGGCGTCAATGTGCCAGAC
TCAAATATAAGGTTCACTGAACTAGCAATTGAAAATAATAAAGGAGTTAATGTGCAACTG
GCAAAGACTGAGACCATGGCAAAAGAGTGGGGTTACTATAAAAGAGCAATAGATAAGAAG
CGTAGAGAACAATAAAATAAGGAGAAAGCTGAGAAGAGAGACGAAGAAAGAGGAGGAGGC
TACAATTCATACAAGAGATTTGATGATGGTGGCAGAGGAGGAAGAGATGGCGGTGATAGG
AGAAACGATCGTGAAAACTTCTCAAGACCTCCAGGCGGTGGCTACGGTGGCGGAGATAGA
AATAGAGACGGTGGAAGATAAGATGATAGAAGAGGTGGCGGCCAATATAATGGCGGTGGC
AGAGATAACTATAGAAGCGGCGGTTTTGCTGGTGATTAGAGAAGAAGATGA


>Contig424.1.g115(protein)
MDHIRQDLDELMGKDRNHPLHVRLQKRDHFDDDYVCKYNLLSFCPHDLFPNTKADIGPCQ
KRHDDYLKEMFKNDPDREIYQRKYEKELQSLLEQMIAQVDQKMKRSIARVENPGPDHINQ
PEINASQQESLNQKIDQLEQKINFYIERAEKLGEEGQIDESEAIMKVVDDLKKQKTELES
LTDVNMIPKDKNMKVCPVCGALQASTDTDKRLQMHQEGKLHTGYQKIRKVLAELKQKREE
YRRLNERQGKRRSRSRSVSPTKVALPRRNIHGHNPQADDKVNEAFYFSSKKYGSGVNVPD
SNIRFTELAIENNKGVNVQLAKTETMAKEWGYYKRAIDKKRREQQNKEKAEKRDEERGGG
YNSYKRFDDGGRGGRDGGDRRNDRENFSRPPGGGYGGGDRNRDGGRQDDRRGGGQYNGGG
RDNYRSGGFAGDQRRR