Identifiers and Description

Gene Model Identifier

Contig15180.0.g94

Standard Name

LTN1b

Aliases

Contig15180_0_g94

Description

RING-H2 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002184702.9987037581344066e-55hypothetical protein
SGDYMR247C5.001425520048966e-32RKR1 SGDID:S000004861, Chr XII
I from 768039-763351, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15180.0.g94(coding)
ATGAACTCAGAACAAAAAGATTTTAAGGCTGTCAAAGTCTAGATGAAATCAAGCTAAAAG
ACAGGCGAAACTCTTTCAAGAAGTATGTTGTACTCTGGTATCAACATTTTCGGTCAACTT
TCATAGCTATATTTGCAAAATAAAGAAGCAGGTGGTTCTTACAATGCCTTCTCTGCTCAG
GTCAAGCCAAACAACTCAGCTGCTGATGGAGGTGAAGGTTCTATGATGAATTTATCTCAA
GAGGTTCTTGCTATATTTAAAAGAATGTAGAAGAAAGATTCTACCACTAAAATCAAGGCA
TTTGCAGAGCTTGATAGATATCTTGAGCAAATAGATTAGTCTGATATTTCCTAGCTAGAA
TCTGATTCAGATGAACTATAAAATCTCTTAACTTTCTTCCTTTATCATTTCTGCAGGATC
ATCATCAATGAGCCTGATAAAAAAGTAAGAGAGGCAGCTCATCAATCATTCTCCTAGTTC
ATTAAGAAAGCAAAAAGAAGAATTGGACCTCACTTAAAGAAAATATTCTCACTTTGGTAC
TGCTCATTCTTTGACATATCTCAAGAAGTTGCTCAATTGGCAAAGAAAAATTTTGAGCTT
GCTTTTCCAGAAAATAAGAGGGAATAAGTATTCAAAATTGCATTCAAAAATTTCCTTAAT
TTTGCTAATGACTAACTAAAACAAAGCGAGGATTAAATCAGTGATAGTGCTGCAGATCTA
TCAAAAGCTTAGAGAGAAGATGTCTTTGATAGGATAACAAGTAGTGTCTTATTAGCACTC
GCTAACAGCTTTGGCTTTACAAAATCATGGAGTGAAGAGGAGTAATAACACTTTATAAAA
AAGCTGATTGATATTCTTGACCTTAACGTCCAAATTTCAAATGAAGATACTAAAGATAAG
AAAGGCAAGCAAAAGTAAAGTTAAAGCTATCTTTGGGGATTCTTGCAATCAAATTATAGA
GGTAGAGTGAGATCTTCTTGTCTATAATTCATCTCAAACTTACTGCTTAATCTTCCATAG
GATATTGTTAAATAGCATATTAACTAGTTATCTCCACAAATTTACAAACTTGTCGGAGAA
GACAATTCATCCCTTTAAACAACTCTCTGGAGAGAGGCCTTATTCAATTTAGGCAAAAAT
TATCCACAGTCTTGGGAAACAATCAATATTAAAAAGGATTTCCTTCCAAAGCTCTATATT
TCTTTGAAAAATGCAGGCTTTGGAGCTCCTTAAGCTCTTTATGAAAATTTCATTAAATTT
GCCTCTATCTTCCCATTCTATCATATTCATAATTATACTGAGGATAAAACAAACAAAGCC
TCATTCAAAGAGAGATGTAACTTGATTAGAGAAGCTTTCACAACTATTTATCAAGGCCTA
AGAAATGATGAATCCGTGGCATTCCACAGTGAGCTAGCAAAATGCTACTATGAGACATTA
GCATTTATCTTACTCAAAAGAATTTAGCCATTAATATAATCAAATGACACTTCTGAAGAT
GACAAAACCTTTGCTCTTGAACAAATAAAGAAGACAATTCAAGTCCCAGTTGAAGATTAC
ATAAATAACTATGAGAGATTCGTCAGCAAGGTTCAAAATTAAAGGAATATCAGACACACA
ATTCCTCAAAGAGTGTCAAAGCTATTAACAGATCTTTCTGAAAGAGATGCAGAGTTAATC
ATTTTTTAAACTGTGATAAATAATATTTGGGATAGCGTTTAATTATCACTTGATAAGTAA
AACACAATCAGATTGTTGTACGGCTTAATCAAGAACAAAAGCAAGTATTTTGAGAAGTAT
ATTCTTGAAAATCTAATTATAAGAGCTGTTAATTTCTTAATAGAAAACGTAGCTGCAGAA
ATAAAAGATCTAAGCAAAGATAACATTGACAAAGCATAGTAAAAACTAATTAACCTCTAG
AGTTTACTCTACAAGCTAAACAAGCAATCAATCATTGTTCCAAAAGGCTAGATTCAGCTT
GAATAAATCATTTAAACCCTGAAAGAGTTAGTTCAAAAAGAGGAGCTTGCTAAAAATGTT
CTTAAGGAAGATATGATTATCAAATTCAATACACTTAAGGAGCATTTAGTGAAGTGTGTC
GTCCTTACTATAAATATCTAAGATTCACCTATCTAAAATTAAACAATCAAATTAATGCTT
CTCGATTTGCCTTTGTCTAATTCGTTAAGAGTTAAAACTTTGATTCCATAGAAAGAATTC
TAGAAAGTTAACTTTGAAAGATATCTCAACAAGTTAAAGTAGCAGGGAGATAAGGAGACA
GTTCTTGGATTTGTGAAAAATGAGCTAATAGGTAATGAAAAATTAATAAGCTCTAATTCA
ATTGTGCTTTAATTGGCTCTTGAAAACACAGTCTAAGGAAAGCCTTCATTTATTGAAGAT
AAGGATCTTGATGAAATTTCATAACAAGTTTTGGATAAAATTAAGTAACATTTAAAGGAT
GCATAAGTAATAGCATTTTACTTCTAATCAGTTAAACCTTTACTTAAACTAACTGCTGAC
AAAAGATTCGATTAATTAAGAAACTAGCTATTCGAGAGACTTTTAAACATCAAGTTGAAC
AACAAGAATTACAAGCAACTTTGGTCTTTATTTGAAGAAGTCTTAAAAGATTCTATTTAT
AGGAAGGAAGATGAATTTTTCAATCACTGCCAATCAGAATTAAAGCAATAATTAAGCGTT
TGTATTGCACATAACTCCAGTTTCGAGCTCGAAACTTTTGATAAGCTTACAAGCATAATC
AAATCATTTGTCTAGCTTTGCAAAAATAAGCAGGAAATTGTTGAGGAAATTTTACTCTAA
AGAGAAAACTTTTCAAACTTAGAAAACAACAGTTTACCTCTTAAGATGTTCAAAGATCTA
CTCTTGTCAGGAGGAATTGGCTTTGACATCACAAAATTATTCTCACAAGACTTAAACTAT
GTGTGGTTAATATCTGAGCTGCTAAACTCTAGACATTTGCAATCACTTGCTAACTTTATG
TAGCTTAAGAAGTAACTGCTCATCTTTGTTGACACAGAAGTTATTCCAGTATTAATATAT
TAGACTCAAAATGGAAATGAAAAGTTGGTTCTGTAAATCTGCAACTATATGAGTGATCAA
GCTCATTCAAGAGTTGATTATGTATACACTCTTGAGAACTTAATCAAAAGATTGATAGAT
CCTGGTGAAGATTATCCAGCTGACGAAAAGCCTGTTTTAAAAATTGCTGACTTTAAGCAA
ATCTTCAATCATGTCTCTAAAGATCAAGTCCAAGAATACTTGAATGATTCCTTAGTTCAT
TACTCACTATAAACAAACCTATTTTTAAGAATGATCTAACAGCTAAGCTACTTTTTGGTT
GATGAGGCTTAAGTTTAAGAAATTTTTAAAAAATCTATTGCATATCTGACAAACTAACTT
CAACAGCAAATCATGAATTTCGATGATCAATTTGGAATAAGCCTTGAGATCTTCACATAT
TTGTCAGAGTATTTCTAAAGTGAAGTTGAATAAGATTTACAAAAGAACTTACTAATAAAA
CTTTTAAAGAACTCAGATCACCTTAGTGAAGACTCTAATGTCATAAATTCAGTTTTATTA
TTCATCGCCAAGAACTTAAACACTATAGGTGTTTCTAAATTTAACAGTTTGATTATTGAG
AAGCAAGTTGATTTCTAAAGTTTCATTAGCTAATATTTAGAAAACGAGGAAGACGATGAT
TCAACATTTGAAAACTTTGAATTCGAGATGCTTCAAGAACTTTCAGAAACTCTTTTAGTC
TTCCCTAGTTACATCAATTCACAGCTTAATGAGAACAATCTCTATATTTTGATAAGCAGT
GGTATTGAGACTTTGCAAAAATCAGCCTTCGTACTGCTTAAGTATCTTTATGAGAACTTC
TTGCCATAAATTGAATTTATCTTTGATGTCAATGATCAGCTCGAACAACTTAAAGAGGAG
GCCGAATAAGGAGAATTGGAAGATGAGGAGAGTAAGTAATAAAAAGTACAGGAGAAATAA
AAGTACAAAAACAAACTTGCTTTCAAAAACATCTCTGAAATTTTAATTGAGTTACTCGAA
AGTCCCCCTAACATCAATTAAAATGAGCAAGATTAAAAGCAAATACTTGTGGGATAAACC
TAGCTTGACTCTATTATCTTTGGTGATAACAAAGAAGGATGCATGAATACTAAGATCTAT
GGTTACTTCTTAGCATGGAATGCACTCTTGATTAAGATTGAGAATGGTAGAATTAAATGT
CAGCTATAGAAGAACTCAGAATACCAAACTGTGTTGGGAGCCTTGAATGAGTATCTTGAG
GAGAATTACGAAATCTATCAAATGCTTCTTGTCAGTTTAATTGCCTATATGCCTGACTTC
AAGAAGGGTCTTGCCGATGCTTTTAATGTCTAAAGCTTTGACCCAGAGTATATTGAACTT
TAAGAACCAAAGTAAAATGCTCTTTATGCAGTATATACTTTAGTCAACTTCATGAAAAGT
TTTCCTTCTCTTGCTAGAAAATACTATTCTGATTGTGATAGATAGCTACTTAATGTAGTA
ATGCCTTATATCAAGTAAGTTGTAAGCCCAGCTATTCTAGATAATGAGATTAGAAAGATC
GAAATTGCTCAGACAGAGCTTGGTGGAAAAGGACTCACTTTTTCACTTTTCAAGTCAACC
AAGGAGATTCAAGCTTACTATAAGTAGGGTGAAATAGAAATGACTCTTAAGATTAGAATT
CCATCAGACTATCCACTCAAGATTGTAGAAGCTGACATTACAAACGGTATTAAGACTTCG
AACTAGCAACAAAGAAAGTGGATTCTTTAAATTAAGAAAATCTTATAATTCCAAAATGGA
GATATCATTACAGCTGTATTGTCATGGAAGAACAATGTTGAGAAAGAAATTGAAGGAGTT
GAGGACTGTTACATTTGCTATTCAGTTGTGCACGAGTAGGATCAGAGCTTGCCAAAARTA
CCTTGCAAGACTTGCAAGAATAAGTTCCATGCTGCTTGTATCAGAAAGTGGTTTAAAACT
TCTCACAAGAGTAATTGCCCTATTTGCTAGAACTATTTCTTCTGA


>Contig15180.0.g94(protein)
MNSEQKDFKAVKVQMKSSQKTGETLSRSMLYSGINIFGQLSQLYLQNKEAGGSYNAFSAQ
VKPNNSAADGGEGSMMNLSQEVLAIFKRMQKKDSTTKIKAFAELDRYLEQIDQSDISQLE
SDSDELQNLLTFFLYHFCRIIINEPDKKVREAAHQSFSQFIKKAKRRIGPHLKKIFSLWY
CSFFDISQEVAQLAKKNFELAFPENKREQVFKIAFKNFLNFANDQLKQSEDQISDSAADL
SKAQREDVFDRITSSVLLALANSFGFTKSWSEEEQQHFIKKLIDILDLNVQISNEDTKDK
KGKQKQSQSYLWGFLQSNYRGRVRSSCLQFISNLLLNLPQDIVKQHINQLSPQIYKLVGE
DNSSLQTTLWREALFNLGKNYPQSWETINIKKDFLPKLYISLKNAGFGAPQALYENFIKF
ASIFPFYHIHNYTEDKTNKASFKERCNLIREAFTTIYQGLRNDESVAFHSELAKCYYETL
AFILLKRIQPLIQSNDTSEDDKTFALEQIKKTIQVPVEDYINNYERFVSKVQNQRNIRHT
IPQRVSKLLTDLSERDAELIIFQTVINNIWDSVQLSLDKQNTIRLLYGLIKNKSKYFEKY
ILENLIIRAVNFLIENVAAEIKDLSKDNIDKAQQKLINLQSLLYKLNKQSIIVPKGQIQL
EQIIQTLKELVQKEELAKNVLKEDMIIKFNTLKEHLVKCVVLTINIQDSPIQNQTIKLML
LDLPLSNSLRVKTLIPQKEFQKVNFERYLNKLKQQGDKETVLGFVKNELIGNEKLISSNS
IVLQLALENTVQGKPSFIEDKDLDEISQQVLDKIKQHLKDAQVIAFYFQSVKPLLKLTAD
KRFDQLRNQLFERLLNIKLNNKNYKQLWSLFEEVLKDSIYRKEDEFFNHCQSELKQQLSV
CIAHNSSFELETFDKLTSIIKSFVQLCKNKQEIVEEILLQRENFSNLENNSLPLKMFKDL
LLSGGIGFDITKLFSQDLNYVWLISELLNSRHLQSLANFMQLKKQLLIFVDTEVIPVLIY
QTQNGNEKLVLQICNYMSDQAHSRVDYVYTLENLIKRLIDPGEDYPADEKPVLKIADFKQ
IFNHVSKDQVQEYLNDSLVHYSLQTNLFLRMIQQLSYFLVDEAQVQEIFKKSIAYLTNQL
QQQIMNFDDQFGISLEIFTYLSEYFQSEVEQDLQKNLLIKLLKNSDHLSEDSNVINSVLL
FIAKNLNTIGVSKFNSLIIEKQVDFQSFISQYLENEEDDDSTFENFEFEMLQELSETLLV
FPSYINSQLNENNLYILISSGIETLQKSAFVLLKYLYENFLPQIEFIFDVNDQLEQLKEE
AEQGELEDEESKQQKVQEKQKYKNKLAFKNISEILIELLESPPNINQNEQDQKQILVGQT
QLDSIIFGDNKEGCMNTKIYGYFLAWNALLIKIENGRIKCQLQKNSEYQTVLGALNEYLE
ENYEIYQMLLVSLIAYMPDFKKGLADAFNVQSFDPEYIELQEPKQNALYAVYTLVNFMKS
FPSLARKYYSDCDRQLLNVVMPYIKQVVSPAILDNEIRKIEIAQTELGGKGLTFSLFKST
KEIQAYYKQGEIEMTLKIRIPSDYPLKIVEADITNGIKTSNQQQRKWILQIKKILQFQNG
DIITAVLSWKNNVEKEIEGVEDCYICYSVVHEQDQSLPKXPCKTCKNKFHAACIRKWFKT
SHKSNCPICQNYFF