Identifiers and Description

Gene Model Identifier

Contig19440.0.g41

Standard Name

LTN1a

Aliases

Contig19440_0_g41

Description

RING-H2 zinc finger

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_002184703.000969471571755e-58hypothetical protein
SGDYMR247C5.001425520048966e-32RKR1 SGDID:S000004861, Chr XII
I from 768039-763351, Gen...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19440.0.g41(coding)
ATGAACTCAGAACAAAAAGATTTTAAGGCTGTCAAAGTCTAGATGAAATCAAGCTAAAAG
ACAGGCGAAACTCTTTCAAGAAGTATGTTGTACTCTGGTATCAACATTTTCGGTCAACTT
TCATAGCTATATTTGCAAAATAAAGAAGCAGGTGGTTCTTACAATGCTTTCTCTGCTTAA
GTCAAGCCAAACAACTCAGGAGCTGATGGAGGTGAAGGTTCTATGATGAATCTATCTCAA
GAGGTTCTTGCTATATTTAAGAGAATGTAGAAGAAAGATTCTACTACTAAAATCAAGGCA
TTTGCAGAGCTCGATAGATATCTTGAGCAAATAGATTAGTCTGATATTTCCTAGCTAGAA
TCTGATTCAGATGAACTATAAAATCTCTTAACTTTCTTCCTTTATCATTTCTGCAGGATC
ATCATCAATGAGCCTGATAAAAAAGTAAGAGAGGCAGCTCATCAATCATTCTCCTAGTTC
ATTAAGAAAGCAAAAAGAAGAATTGGACCTCACTTAAAGAAAATATTCTCACTTTGGTAC
TGCTCATTCTTTGACATATCTCAAGAAGTTGCTCAATTGGCAAAGAAAAATTTTGAGCTT
GCTTTTCCAGAAAATAAGAGGGAATAAGTATTCAAAATTGCATTCAAAAATTTCCTTAAT
TTTGCTAATGACTAACTAAAACAAAGCGAGGATTAAATCAGTGATAGTGCTGCAGATCTA
TCAAAAGCTTAGAGAGAAGATGTCTTTGATAGGATAACAAGTAGTGTCTTATTAGCACTC
GCTAACAGCTTTGGCTTTACAAAATCATGGAGTGAAGAGGAGTAATAACACTTTATAAAA
AAGCTGATTGATATTCTTGACCTTAACGTCCAAATTTCAAATGAAGATACTAAAGATAAG
AAAGGCAAGCAAAAGTAAAGTTAAAGCTATCTTTGGGGATTCTTGCAATCGAACTATAGA
GGAAGAGTGAGATCCTCTTGTCTATAATTCATCTCAAACTTACTGCTTAATCTTCCATAG
GATATTGTTCAATAGCATATTAATCAATTATCTCCACAAATTTACAAACTTGTCGGAGAA
GACAATTCATCCCTTTAAACCACTCTCTGGAGAGAAGCCTTATTCAATTTAGGCAAAAAT
TATCCACAGTCTTGGGAAACAATAAATATTAAAAAGGATTTCCTTCCAAAGCTTTATATT
TCCTTGAAGAATGCAGGTTTTGGAGCTCCTTAAGCTCTTTATGAAAATTTCATTAAATTT
GCCTCTATCTTCCCATTCTATCATATTTACAATTACACTGAAGATAAAACAAATAAGGCT
TCATTCAAAGAGAGATGTAACTTAATTAGAGAAGCTTTCACCACTATTTATTAAGGCCTA
AGAAACGATGAATCCGTGGCATTCCACAGTGAGCTAACAAAATGCTACTATGAGACATTA
GCATTTATCTTACTTAAAAGAATTTAGCCATTAATATAATCAAATGACGCTTCTGAAGAT
GACAAAACCTTTGCACTTGAACAAATAAAGAAGACAATTCAAGTCCCAATTGAAGATTAC
ATCAATAATTATGAGAGATTCGTCAGCAAGGTTCAAAATTAAAGGAATATCAGACACACA
ATTCCTCAAAGATTGTCAAAGTTATTAACAGATCTTTCTGAAAGAGATGCAGAGTTAATC
ATTTTTGAAACTGTGATTAACAATATTTGGGATAGCGTTTAATTATCACTTGATAAGCAA
AACACAATCAGATTGTTGTACGGCCTAATTAAGAACAAAAGCAAGTATTTCGAGAAGTAT
ATTCTTGAAAATCTAATTATAAGAGCTGTTAATTTCTTAATAGATAACGTAGCTGCAGAA
ATAAAAGATCTAAGCAAAGATAATATTGACAAAGCATAGTAAAAACTAATTAACCTCTAG
AGTTTACTCTACAAGCTAAACAAGCAATCAATCATTGTTCCAAAAGACTAGATCCAGCTT
GAATAAATCATTTAAACCCTGAAAGAGTTAGTTCAAAAAGAGGAGCTTGCTAAAAATGTT
CTTAAGGAAGATATGCTTATTAAATTCAATACTCTTAAGGAGCATTTAGTGAAGTGTGTC
GTCCTTACTATAAATATCTAAGATTCACCTATCTAAAATTAAACAATCAAACTTATGCTT
ATCGATTTGCCTTTGTCTAATTAGTTAAGAGTTAAAACTTTGATCCCACAGAAAGAATTC
TAGAAAGTTAACTTTGAAAGATATCTCAACAAGTTAAAGTAGCAGGGAGATAAGGAGACA
GTCCTTGGATTCGTGAAAAATGAGCTAATTGGCAATGAAAAGTTAATAAGCTCTAATTAA
ATTGTGCTTTAATTGGCTCTTGAAAACACAGTCTAAGGAAAGCCTTCATTTGTTGAAGAT
AAGGATCTTGATGAAATTTCATAACAAGTCTTGGATAAAATTAAGTAGCATTTAAAGGAT
GCTTAAGTTATAGCATTTTACTTCTAATCAGTTAAACCTTTACTTAAACTAACTGCTGAC
AAAAGATTCGATTAAATAAGAAACTAGCTATTCGAGAGACTTTTAAACATCAAATTGAAC
AACAAGAATTACAAGCAACTTTGGTCTTTATTTGAAGAAGTCTTAAAAGATTCTATTAAT
AAGAAGGAAGAGGAATTTTTCAATCACTGTCAATCAGAGTTAAAGCAATAATTGAGCGTT
TGCATTGCACATAACTCCAGTTTTGAGCTCGAAACTTTTGATAAGCTTACAAGTATCATC
AAATCATTTGTCTAGCTTTGCAAAAATAAGCAGGAGATCGTTGAGGAAATTTTACTCTAA
AAAGAAAATTATTCAAACTTAGAAAACAATAGCTTGCCGCTTAAGATGTTCAAAGATTTA
CTCTTGTCAGGAGGAATTGGTTTTGACATCACAAAACTATTTTAACAGGACTTAAATTAC
GTGTGGTTAATATCTGAGCTCCTAAACTCTAGACATTTGCAATCGCTTGCTAACTTCATG
TAGCTTAAAAAGTAACTACTCATCTTTGTTGACACAGAAGTAATTCCAGCATTAATCTTT
TAGACTTAAAATGGAAATGAAAAGTTGGTTCTCTAAATCTGTAATTACATGAGTGATCAA
GCTCATTCAAGAGTTGATTATGTATACACTCTTGAGAATTTAATCAAAAGATTGATAGAT
CCTGGTGAAGATTATCCAGCTGACGAAAAGCCTGTTTTAAAAATTGCTGACTTTAAGCAA
ATCTTCAATCATGTCTCTAAAGATCAAGTCCAAGAATACTTGAATGATTCCTTAGTTCAT
TACTCACTATAAACAAACCTATTTTTAAGAATGATCTAACAGCTAAGCTACTTTTTGGTT
GATGAGGCTTAAGTAGAAGAAATTTACAAAAAATCTATTGCATATCTGACCAACTAACTT
CAACAGCAAATCATGAATTTCGACGATCAATTTGGAATAAGTCTTGAAATCTTTACATAT
TTGTCAGACTATTTCTAAAGTGAAATTGAATAGGATTTACAAAAGAACTTACTAATTAAA
CTATTAAAGAACTCAGATCACCTAAGTGAAGACTCTAATGTCATAAATTCAGTTTTATTA
TTCATCGCAAAGAACTTAAACACTATAGGTGTTTCTAAATTCAACAAAATTCAGTCACAT
AAGCATGTGCTACCTTTGACTTACATAAGTCTTTTCTAAATAATAAGAAAGACAATTGGA
AGTGACTTAATTAAGGACAAAACAACTCTGATAAATTAAGTCATTGAAATTGCAAAGGAT
CATGCTCTTAATTTTGAGGTTAAAATGACCAAAATATAGCAAAGTGTTATTAACATTCAA
GAAACTGATGATATAGATTTAGAAAACGAAGAAGAAGATGATTCAACATTTGAAAACTTT
GAATTCGAGATGCTTCAAGAACTTTCAGAAACACTATTAGTCTTCCCTAGTTACATCAAT
TCACAGCTCAATGAGAACAATCTCTATATTTTGATAAGCAGTGGCATCGAAACATTGCAA
AAATCAGCCTTCGTTTTACTTAAGTATCTTTATGAGAACTTCTTACCATAAATTGAATTT
ATCTTTGATGTTAATGATCAGCTTGAACAACTTAAAGAGGAGGCCGAAGAAGAATAGGAA
GATGAAGAGAGTAAGCAATAAAAAGTACAGGAGAAGTAAAAGTACAAAAACAAACTTGCT
TTCAAGAACATCTCTGAAATATTAATTGAGCTTCTCGAAAGTCCACCTAACATCAATTAA
AATGAGCAAGATCAAAAGCAAATACTTGTGGGATAAACTTAGCTTGACTCGATTATCTTT
GGTGATAACAAAGAAGGATGTATGAATACTAAGATCTATGGGTACTTCTTAGCATGGAAT
GCCCTCTTAATTAAGATTGAAAATGGTAGAATCAAATGTCAGCTATAGAAGAACTCAGAA
TATCAAACTGTTTTGGGAGCCTTGAATGAGTATCTTGAGGAAAATTACGAAATCTATCAA
ATGCTTCTTGTCAGTTTGATTGCCTATATGCCTGACTTCAAGAAGGGTCTCGCCGATGCT
TTTAATGTCTAAAGCTTTGACCCAGAGTATATTGAACTTTAAGAACCAAAGTAAAATGCT
CTTTATGCAGTATATACTTTAGTCAACTTCATGAAAAGTTTTCCTTCTCTTGCTAGAAAA
TACTATTCTGATTGTGATAGATAGCTACTTAATGTAGTAATGCCTTATATCAAGTAAGTT
GTAAGCCCAGCTATTCTAGATAATGAGATTAGAAAGATCGAAATTGCTCAGACAGAGCTT
GGTGGAAAAGGACTCACTTTTTCACTTTTCAAGTCAACCAAGGAGATTCAAGCTTACTAT
AAGTAGGGTGAAATAGAAATGACTCTTAAGATTAGAATTCCATCAGACTATCCACTCAAG
ATTGTAGAAGCTGACATTACAAACGGTATTAAGACTTCGAACTAGCAACAAAGAAAGTGG
ATTCTTTAAATTAAGAAAATCTTATAATTCCAAAATGGAGATATCATTACAGCTGTATTG
TCATGGAAGAACAATGTTGAGAAAGAAATTGAAGGAGTTGAGGACTGTTACATTTGCTAT
TCAGTTGTGCACGAGTAGGATCAGAGCTTGCCAAAARTACCTTGCAAGACTTGCAAGAAT
AAGTTCCATGCTGCTTGTATCAGAAAGTGGTTTAAAACTTCTCACAAGAGTAATTGCCCT
ATTTGCTAGAACTATTTCTTCTGA


>Contig19440.0.g41(protein)
MNSEQKDFKAVKVQMKSSQKTGETLSRSMLYSGINIFGQLSQLYLQNKEAGGSYNAFSAQ
VKPNNSGADGGEGSMMNLSQEVLAIFKRMQKKDSTTKIKAFAELDRYLEQIDQSDISQLE
SDSDELQNLLTFFLYHFCRIIINEPDKKVREAAHQSFSQFIKKAKRRIGPHLKKIFSLWY
CSFFDISQEVAQLAKKNFELAFPENKREQVFKIAFKNFLNFANDQLKQSEDQISDSAADL
SKAQREDVFDRITSSVLLALANSFGFTKSWSEEEQQHFIKKLIDILDLNVQISNEDTKDK
KGKQKQSQSYLWGFLQSNYRGRVRSSCLQFISNLLLNLPQDIVQQHINQLSPQIYKLVGE
DNSSLQTTLWREALFNLGKNYPQSWETINIKKDFLPKLYISLKNAGFGAPQALYENFIKF
ASIFPFYHIYNYTEDKTNKASFKERCNLIREAFTTIYQGLRNDESVAFHSELTKCYYETL
AFILLKRIQPLIQSNDASEDDKTFALEQIKKTIQVPIEDYINNYERFVSKVQNQRNIRHT
IPQRLSKLLTDLSERDAELIIFETVINNIWDSVQLSLDKQNTIRLLYGLIKNKSKYFEKY
ILENLIIRAVNFLIDNVAAEIKDLSKDNIDKAQQKLINLQSLLYKLNKQSIIVPKDQIQL
EQIIQTLKELVQKEELAKNVLKEDMLIKFNTLKEHLVKCVVLTINIQDSPIQNQTIKLML
IDLPLSNQLRVKTLIPQKEFQKVNFERYLNKLKQQGDKETVLGFVKNELIGNEKLISSNQ
IVLQLALENTVQGKPSFVEDKDLDEISQQVLDKIKQHLKDAQVIAFYFQSVKPLLKLTAD
KRFDQIRNQLFERLLNIKLNNKNYKQLWSLFEEVLKDSINKKEEEFFNHCQSELKQQLSV
CIAHNSSFELETFDKLTSIIKSFVQLCKNKQEIVEEILLQKENYSNLENNSLPLKMFKDL
LLSGGIGFDITKLFQQDLNYVWLISELLNSRHLQSLANFMQLKKQLLIFVDTEVIPALIF
QTQNGNEKLVLQICNYMSDQAHSRVDYVYTLENLIKRLIDPGEDYPADEKPVLKIADFKQ
IFNHVSKDQVQEYLNDSLVHYSLQTNLFLRMIQQLSYFLVDEAQVEEIYKKSIAYLTNQL
QQQIMNFDDQFGISLEIFTYLSDYFQSEIEQDLQKNLLIKLLKNSDHLSEDSNVINSVLL
FIAKNLNTIGVSKFNKIQSHKHVLPLTYISLFQIIRKTIGSDLIKDKTTLINQVIEIAKD
HALNFEVKMTKIQQSVINIQETDDIDLENEEEDDSTFENFEFEMLQELSETLLVFPSYIN
SQLNENNLYILISSGIETLQKSAFVLLKYLYENFLPQIEFIFDVNDQLEQLKEEAEEEQE
DEESKQQKVQEKQKYKNKLAFKNISEILIELLESPPNINQNEQDQKQILVGQTQLDSIIF
GDNKEGCMNTKIYGYFLAWNALLIKIENGRIKCQLQKNSEYQTVLGALNEYLEENYEIYQ
MLLVSLIAYMPDFKKGLADAFNVQSFDPEYIELQEPKQNALYAVYTLVNFMKSFPSLARK
YYSDCDRQLLNVVMPYIKQVVSPAILDNEIRKIEIAQTELGGKGLTFSLFKSTKEIQAYY
KQGEIEMTLKIRIPSDYPLKIVEADITNGIKTSNQQQRKWILQIKKILQFQNGDIITAVL
SWKNNVEKEIEGVEDCYICYSVVHEQDQSLPKXPCKTCKNKFHAACIRKWFKTSHKSNCP
ICQNYFF