Identifiers and Description

Gene Model Identifier

Contig15780.0.g75

Standard Name

LSM8a

Aliases

Contig15780_0_g75

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_001896179.997764199084386e-16conserved hypothetical protein
SGDYJL124C0.000000000000020000882446601127LSM1 SGDID:S000003660, Chr X f
rom 187644-187126, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig15780.0.g75(coding)
ATGAAAACTTCAGCACTAAATATCACAGGTGGAGGCGTGTCCAAGAGAGGCCGCAAGAGA
AAGTCAACTACTCCTAAAAACGATTTGTACCCTGAATCTTCAAAGAGAAAAGGTCTCGAC
AAATCTAAGATTAACGTCAACGGTGCTTTGGTAGACATAGAAAGTATTTCAGAGGATTAG
CTTTACTCACTAAGAAAAGTCTTGCCACGCAAGGAATATAGATTACTTAAGAATCGTAAG
AGTGCGAGAAAGTCAAGAAAAAGAAGAAAGGTAGAGATGTACAGCTTAAAGGACGAGATT
GATATTCTTAAATAAGAGAACGAAGACCTCAGAGCTTAGTTAAGAATCTAGCAATAAGAA
ATTGAAATTTGCCAGCAAAACCACAATGGCTTAGAACTTAACCAAACAACTTTCACAAAA
GATCTTGACTCAACTTTGAATCATGAGAACGATGAACAGCTCACTAGAAACTCTTTCAGC
TCATCCAATTTATCATCGTCATTGATGATGAGTCTTGCTCCTCCCAAAATTGAGAGCTAG
GCTCCAAATCTTCCTATTCCCAATAATTCAAATTCACACCGCGGTAAACTTGAATTAAAT
TTAATGGTTATTAATGATGCCCTAGATCATTAAGCAATAATAATAACAATAATAATTATT
AACTTAATGGCAACTTTTGTAGAGCAACTTGTCGAAAAGACCGTTAATGTGATTACCAAT
GATGGACGCAACTTCATTGGGACCCTTGTATCCTTCGACCAGAAAACTAACCTTATTCTC
TCAGCCTGCATCGAGCGTATCTATATTGAAAACCACGATGTCCAAGCAGAAGAGATGGGG
GTCTTTTTTATCAGAGGAGACAACGTGTGCTTGATCGCAGAGATCGATGAAAACCTCGAG
AGAGGTATCGACTACTCCAAGATCAGAGCGCAACCCATCAAATCAGTATTATTGCACTGA


>Contig15780.0.g75(protein)
MKTSALNITGGGVSKRGRKRKSTTPKNDLYPESSKRKGLDKSKINVNGALVDIESISEDQ
LYSLRKVLPRKEYRLLKNRKSARKSRKRRKVEMYSLKDEIDILKQENEDLRAQLRIQQQE
IEICQQNHNGLELNQTTFTKDLDSTLNHENDEQLTRNSFSSSNLSSSLMMSLAPPKIESQ
APNLPIPNNSNSHRGKLELNLMVINDALDHQAIIITIIIINLMATFVEQLVEKTVNVITN
DGRNFIGTLVSFDQKTNLILSACIERIYIENHDVQAEEMGVFFIRGDNVCLIAEIDENLE
RGIDYSKIRAQPIKSVLLH