Identifiers and Description

Gene Model Identifier

Contig18849.0.g107

Standard Name

LSM7

Aliases

Contig18849_0_g107

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_008353406.002718307283067e-26Sm protein
SGDYNL147W1.9999391735788327e-19LSM7 SGDID:S000005091, Chr XIV
from 350940-350957,35105...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18849.0.g107(coding)
ATGAACAACAGAGTAAGTATACATAATTCTTGCAACCAATCTTATTGGTATTTCATGTTT
GGAATATATATTTATAATTTACAGGGAAGAGACAGAGGGGGAGATAGAGACAGCTAAAAA
CGTACAAGAGAATCAGCTATAGATCTCGCACCCTTGGTTGATAAGAAACTCAGAATAAAA
TTTGTGGGGGGTCGTGAAGTCACAGGAATACTGAAGGGAGCAGACCCTACTTCAAATCTT
GTTCTTGATGATGCTATTGAATATATAAGAGATGCGAAAGATCCATATAACATAACAGAG
TAGACAAGGGAACTAGGGTTTTTGGTTGCAAGAGGGACAACTATTCTTTCCATAGCAACT
GAAGAAGGAGCTTTTATCAACATTGAAAATCCTTATGCAGTCACTGAATGA


>Contig18849.0.g107(protein)
MNNRVSIHNSCNQSYWYFMFGIYIYNLQGRDRGGDRDSQKRTRESAIDLAPLVDKKLRIK
FVGGREVTGILKGADPTSNLVLDDAIEYIRDAKDPYNITEQTRELGFLVARGTTILSIAT
EEGAFINIENPYAVTE