Identifiers and Description

Gene Model Identifier

Contig152.1.g18

Standard Name

LSM5

Aliases

Contig152_1_g18

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYER146W0.000000000004997916451710233LSM5 SGDID:S000000948, Chr V f
rom 462585-462866, Genome...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig152.1.g18(coding)
ATGGTAGACAAATGTCAAGGTTAGAGAGTATGGATTATAATGCAAAACGATAAAGAATTC
TCAGGGACTCTTAGGGGTTTCGATGGTTACTTCAACTTGATATTGGATGATGTGAAGGAG
TATTAAGATGCAGGAGCAGGAGGGAAGCGTCTACTGGTGAACCAGGTGGAATCTATGTTG
CTTAATGGCTCTCATATATGTATGATGATACCTGGAGATACTACAGTCCAAGCTGCCAAT
GAATGA


>Contig152.1.g18(protein)
MVDKCQGQRVWIIMQNDKEFSGTLRGFDGYFNLILDDVKEYQDAGAGGKRLLVNQVESML
LNGSHICMMIPGDTTVQAANE