Identifiers and Description

Gene Model Identifier

Contig4137.0.g49

Standard Name

LSM2

Aliases

Contig4137_0_g49

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYBL026W6.001696815660978e-24LSM2 SGDID:S000000122, Chr II
from 170623-170676,170805...
T. thermophilaTTHERM_012890800.00000009004106436083642Sm protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig4137.0.g49(coding)
ATGTTCCAATCTTTCTTCCGCCAACTAGCAGATAAAAATCAGAGAGTGACTCTAGAGCTT
AAAAATGACTTGAAAATCTAAGGGACCTTAGTGAGTGTAGATGAAAGTCTAAATATTCAA
TTGACTAACATGAAAATTGCAGATGAAATCAACAATCCATACTTGCTATCTTGCAAAAAT
GGGTTTATAAGAGGCAATGTGATTAGATACGTGCATTTATCAAAGAAAGAGGTTGACACC
GAGCCACTTACAGAAGCCTGTAAAAAGGAAGCTAAAAGAGATAAATCACAAGTCATGTGA


>Contig4137.0.g49(protein)
MFQSFFRQLADKNQRVTLELKNDLKIQGTLVSVDESLNIQLTNMKIADEINNPYLLSCKN
GFIRGNVIRYVHLSKKEVDTEPLTEACKKEAKRDKSQVM