Identifiers and Description

Gene Model Identifier

Contig7437.0.g75

Standard Name

LSM14b

Aliases

Contig7437_0_g75

Description

Scd6-like Sm domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010935100.00000006998394348458725hypothetical protein
SGDYPR129W0.0000020007268868677913SCD6 SGDID:S000006333, Chr XVI
from 792687-793736, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig7437.0.g75(coding)
ATGTTAACAGCAGTAAACTCAACAACAACAGCAGCATCAGCCAATCAACAACCAGCAGCT
GATGCCAAAGTAGAGCAAAAACCAGCAGCCGCCTATGGAGGACTTCAATCGCAAAACATC
CTAGGAAGCAAATTACAGATTCTGACAATAGCACAAGTTAGATATGAAGGAGTGCTAAGC
GAGATAGACCCTATAAATAAAGCCATGACTCTCATTAACGTGAAAAGTTACGGTTCTGAA
GGGCGTAGAAATGGCTAAAACGAGATCCCGCCCGCAGACGCAGAAATTCAAGAGGCCAGG
TTCAAAGTGGATCACATCAAAGATTTCAAAATCATAGAAAAACCCAATCCTACTCTCCTT
GACCCAGCAATCTTATCCACTAGCACTGAGAAGAAACCTAGTTAGCAATAGGATGAGAAG
AAATAAGTGGGCAGTAGCACACAGCAGTAATAGTAGAATAATACAGGAAGCAATTGGAGA
AACTAGAGCAATGTGTAATAGCAGTAGCAATAGCAATAGGAGCATCACTATCAATAAAAT
CATTAAATCGAAGATCCATATAATGAAAGATCATCATACAATCAGCAATAGTAACATCAA
AGAGGTGGCTACTAAGGCGGCAGAGGCGGAAGAGGCCAAGGTGGTGGAAGCTATGGAGGA
GGCCATCAAAATCAATATCAAGGAGGGTATTAAGGTGGAAACAGAGTTGGCCACTCATAA
TAATATCAATCAAAGAGAATAGTTGGTGAACTCCAGCAAAATCCTAATGAATCTTTGAAA
GAGCAGTTGAAGGAAAACTTTGATTTTTAGTAGCATCAACTCAAGGAGAGCAACCTTGAG
GAAGAAAAGAGGCAAGGTGTTTAAGATGAAGAAAATGCCACTGCAGCAGGATTAGATGAC
CCCAACAAAGAAGAAGCAAAGCCAAAGTACGATAAGTCAGCAGGCTTCTTTGACAGCATA
TCTAATTCCACTCAGAAGAAGAATGATCCCAATGAAATAAGAAGTGATTTCAGGAAGAAA
GACGCAGAGACATTCGGATTGACAAGCTCCGCTAACTTCCAATATGATAATAGCAGAGGC
AGAGGAGGTCGTGGAGGTAGAGGTGGCTATAGAGGTGGCCACAGTGTAAACTACCGTGGT
AATGCCTAAAGAGGTGGATATCATGGTGGTTATCAAGGTGGTTATGATCAAGAATAATCT
CACCAACCATACTCTGGAGGAGGTGGCAATTACCAAGGAGAAAACTTTAATAGAGGAAGA
GGAGGTAATAACAACTATTACTAAGGCGGTGACCGCGGAGGCTATGGTGGAGAACGCGGA
GGCTATGGTGGCGACCGTGGTGGCTATGGTGGCGACCGCGGAGGTTATGGTGGTGAACGT
GGAGGCTACCGTGGAGGTTACAGCGGTGGCTACGATTCATTCTAACAAGAAGGAGGTTAC
CAACCTAGAGGTGGCAGAGGTGGATATCAACCTCGCGGAGGCTACAGAGGAAGGGGTGGC
CAAGCTCCCTAATAAGATCAAGATTTATGA


>Contig7437.0.g75(protein)
MLTAVNSTTTAASANQQPAADAKVEQKPAAAYGGLQSQNILGSKLQILTIAQVRYEGVLS
EIDPINKAMTLINVKSYGSEGRRNGQNEIPPADAEIQEARFKVDHIKDFKIIEKPNPTLL
DPAILSTSTEKKPSQQQDEKKQVGSSTQQQQQNNTGSNWRNQSNVQQQQQQQQEHHYQQN
HQIEDPYNERSSYNQQQQHQRGGYQGGRGGRGQGGGSYGGGHQNQYQGGYQGGNRVGHSQ
QYQSKRIVGELQQNPNESLKEQLKENFDFQQHQLKESNLEEEKRQGVQDEENATAAGLDD
PNKEEAKPKYDKSAGFFDSISNSTQKKNDPNEIRSDFRKKDAETFGLTSSANFQYDNSRG
RGGRGGRGGYRGGHSVNYRGNAQRGGYHGGYQGGYDQEQSHQPYSGGGGNYQGENFNRGR
GGNNNYYQGGDRGGYGGERGGYGGDRGGYGGDRGGYGGERGGYRGGYSGGYDSFQQEGGY
QPRGGRGGYQPRGGYRGRGGQAPQQDQDL