Identifiers and Description

Gene Model Identifier

Contig21291.0.g82

Standard Name

LSM10

Aliases

Contig21291_0_g82

Description

LSM domain

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

  • regulation of mitotic metaphase/anaphase transition (IEA) | GO:0030071
  • anaphase-promoting complex-dependent catabolic process (IEA) | GO:0031145

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
SGDYLR147C0.00000039992052383199455SMD3 SGDID:S000004137, Chr XII
from 434463-434158, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21291.0.g82(coding)
ATGGTTGACACAAAAAATGGCGAGTCATACGATGGGACACTCTTGAAATGTGACGACTGG
ATGAATCTCTATTTAAAGGATGTGATAAGAACAACAACCACGGGATAATTTTCAAAGTTT
GAATAAGTCTTTATACGCGGTAATCATGTCAAAAACATTCAATTGAGTGAGGAAATCATT
GAGAATTATCAAGCAGAACTTAAGAGAAGGTAGGCTGAAAAGGCAATTCAAGGCAATTTT
GAAAGTGAAGGAAAGCAAAGAGGTGGTTCTAGATCACAAAGTCGTGGTGGTAGAAGAGAC
GGGGGTGACAGAGGTCGTGGAGGAGACAGAGGAGGCTTTAGAGGTGGCCGTGGTAGTAGC
AATAATCAATATGGATTTAGCAGTAATCGTGGAGGAAGAGATGGCAGTGAAAGAGGAAGA
GGCGATAGAGGCGATAGAGGCGGTCGTGGTGGCAGAGGTGATAGAGGAGATAGAGGTGGT
CGTGGCGATAGAGGAGGTTTCAGAGGTAGAGGTAACGATATGTCTGGTGGCAGAGGTGGC
CGCGGAGGACGTGGAGGGTATTGA


>Contig21291.0.g82(protein)
MVDTKNGESYDGTLLKCDDWMNLYLKDVIRTTTTGQFSKFEQVFIRGNHVKNIQLSEEII
ENYQAELKRRQAEKAIQGNFESEGKQRGGSRSQSRGGRRDGGDRGRGGDRGGFRGGRGSS
NNQYGFSSNRGGRDGSERGRGDRGDRGGRGGRGDRGDRGGRGDRGGFRGRGNDMSGGRGG
RGGRGGY