Identifiers and Description

Gene Model Identifier

Contig11117.0.g2

Standard Name

LSG1

Aliases

Contig11117_0_g2

Description

50S ribosome-binding GTPase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam01926 ) 50S ribosome-binding GTPase
  • ( pfam02421 ) Ferrous iron transport protein B
  • ( pfam03193 ) Protein of unknown function, DUF258
  • ( pfam04546 ) Sigma-70, non-essential region

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_004404601.0003814179949055e-122conserved hypothetical protein
SGDYGL099W8.001903776189462e-102LSG1 SGDID:S000003067, Chr VII
from 314631-316553, Geno...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig11117.0.g2(coding)
ATGGGAAAGAACTAGAAGACACAAGGAGTAGGCAAATCTCTTATTAAAAAGCACAATGAA
AAATAGAATTAACGTAAAAACAAAACCTCCACATTTAAACAGCACACAAACATTGATGAT
GAGGTGAAGCCAATATTGAAGTCCATCATTGATCAGAACTCCTTGGAGGAATTCGTGCAG
TTGGCTCAACTTTCAAACAAGAAATTCTCAGCTGAAAAAGAGATAACCATTATCAATAAA
AAAGAAATTTTGCAGGGATCCGTGGAGAGTGCTACTGCTTAGAGAGAGCTATTGAATAAT
TTTCTGACAGAATCCACCATTAAAAATCCTCAATATCAGCTGCTGAAGATTCCACGTAAA
CCCTAGTGGGATAGCACTATGACAGCTCAAGAGATTCAAACCAGAGAGAATTTCGCATTT
CTATAGTGGAGAAAGGATATTGCTTCTCTAGAAGAGAATAATGTTAATTTGGCAATCACT
CCATTTGAAAAGAACTTAGAAGTATGGCGTTAACTGTGGCGTGTAATTGAAAAATCAGAC
ATTTTGCTCCAAATCGTGGACGCAAGAAACCCATATTTCTTCTACTCTCAGGATCTCGAG
AAGTATATCGCAGAGGTGAACCCAGACAAAGAATTTATGCTTTTAATTAACAAAGCTGAT
TATTTGACCACAGAGCTTAGAGAGCACTGGTCCAAATACTTCAATGAAAAGGGAGTTAAG
CATTTCTTCTTCAGTGCCTTAGAAGAGCAGGATAAAATCGATAAGGATCAAGTTGAGGAA
GAAAGTGAAGAAGACATTGAAAGCGGAGAAGAAGGAGATTCTGATACTGAAAAACCTAAG
AAATTCAAGTAGGGATTGACTGTAGAGGAAGAAAAGAAGCAAAGATTTGAAAAGCTTAAT
GAAATCGTTTAGAAACTCAGCACACCACATATCTTCACAAGAACCGAAATTATGGATATT
TTGAGAGGGAAATCCCTTTAAATGGGCAAGACTTTTGATGATAGATTAATGATTGGTTTC
GTTGGTTACCCCAACGTAGGAAAATCATCAGTTATTAACGTTATTTGCTAAAAAAAGCGT
GTAGGTGTTGCAAACATGCCAGGTAAAACTAAGCATTTCCAAACTCTAAACATGGAAGAT
AACATGTGCTTGTGCGATTGCCCAGGTCTAGTTTTCCCATCATTCACAAATTCTAAAGCT
GAGATGATGTGCTGTGGTGTCTTGCCAATTGATACCATGAAAGATTATGTTTCCCCAATC
TCACTTATTATCAACAGAGTCCCAAGAGAAGTTTTGGAATCCTACTATAAAGTTCATTTG
CCACCAAAGAACTCCAAAAAGTACACAGCCAGTATTTTCTTATCAATTTATGGAGCCAAG
AAAGGTTACGTGACTGGTCGTGGTATTCCAAACGAAGCTTAAGCTGCAAGAATTGTATTA
AAAGACTATAACTCTGGAAAGTTATTGTTTGTGCATTTGAGACCAGATTACATTCTTGAG
ACTCATGGACCAATCCAATAAAGTGGTTTCCACGATACCAGATTCTAAGTCCTTAGCAGA
GACACAAACAACGGCATGATTGAACAATCTAATAACAATTAAATAGACGAAGAGACTAAG
AGTGAGCAGGATAACGAAGACGACTCTGATGATTTCGAAGATGATGACGAAGATCTTGAG
GAAACCAAAGATGGTTCACTAAGCTTGAACACTGACTTAGTTTCTTCAACAACTGGCCCT
ATTGCAGTATCATCAAACAACATTAAAGTGGAAATCCATCACAAAGAAGACCTAATTGAC
AAGCAGTTCTTCGTTTTGAACTAACAAGTTACTGAGTTGAAGTTGAATAAGGGAGAGAAA
CGTGCTCTTAAATTCGCTATTTTGAGAGGAGTAAAGATTGATGAAATCCCCAACTTGAAG
GAGTACTTGGGAGAGCAAGTGAAGCAAATGAAGGCCAAGAAGACCGTCAGAGGCATCCCA
ATAGCAAAGAAAACTCAAAATGGTGGTAGAGGCGGCAACAACTCAAATAAATTCTATGCC
TTTGCCGAGCTTGACAATGGAAATGAAAGTGATTGA


>Contig11117.0.g2(protein)
MGKNQKTQGVGKSLIKKHNEKQNQRKNKTSTFKQHTNIDDEVKPILKSIIDQNSLEEFVQ
LAQLSNKKFSAEKEITIINKKEILQGSVESATAQRELLNNFLTESTIKNPQYQLLKIPRK
PQWDSTMTAQEIQTRENFAFLQWRKDIASLEENNVNLAITPFEKNLEVWRQLWRVIEKSD
ILLQIVDARNPYFFYSQDLEKYIAEVNPDKEFMLLINKADYLTTELREHWSKYFNEKGVK
HFFFSALEEQDKIDKDQVEEESEEDIESGEEGDSDTEKPKKFKQGLTVEEEKKQRFEKLN
EIVQKLSTPHIFTRTEIMDILRGKSLQMGKTFDDRLMIGFVGYPNVGKSSVINVICQKKR
VGVANMPGKTKHFQTLNMEDNMCLCDCPGLVFPSFTNSKAEMMCCGVLPIDTMKDYVSPI
SLIINRVPREVLESYYKVHLPPKNSKKYTASIFLSIYGAKKGYVTGRGIPNEAQAARIVL
KDYNSGKLLFVHLRPDYILETHGPIQQSGFHDTRFQVLSRDTNNGMIEQSNNNQIDEETK
SEQDNEDDSDDFEDDDEDLEETKDGSLSLNTDLVSSTTGPIAVSSNNIKVEIHHKEDLID
KQFFVLNQQVTELKLNKGEKRALKFAILRGVKIDEIPNLKEYLGEQVKQMKAKKTVRGIP
IAKKTQNGGRGGNNSNKFYAFAELDNGNESD