Identifiers and Description

Gene Model Identifier

Contig9075.0.g84

Standard Name

LSF1z

Aliases

Contig9075_0_g84

Description

Transient receptor potential (TRP) ion channel

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam06011 ) Transient receptor potential (TRP) ion channel
  • ( pfam10144 ) Bacterial virulence factor haemolysin

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003104900.0005997485943342685hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9075.0.g84(coding)
ATGAATATAGATTTCCCCAATAATGTGCAAACTTTCTCAGGGTATCTCAAAGTAGCTTCA
GGAGATATTGAAGAAAAGCAATAGTACGTTACAAATATTGCAGACTATATTATAAACATA
AAACATGTAGAAAGGCCTATGGATAACGAGAAATTGCAATAAAAATTTATTGATGATGAA
GTACCACCCTATTTTATAGTGGCTTTTGGTTTAAAATTGACATTTCGGTGCCTTGGATTT
TTGATAATTCTTCCATTCTCGTTAATATTGAACAAACTATGTAAAAAAGTTAAATTATGG
GAAGAAATTATTGGTGCATTTTTCTTTAACCTACCTTTAAGAACTTTCATTGAGATGTAC
ATAGAGTTGATATTATAGGTTGTTATAAATACTCAATTTATCAAGTTCAAAAACATTGAT
CAAATGATAACTACTTTAATTGCATTTATATTTGGAGCTATTTCTTTGCTATTGCCATCT
ATGGGAATGACTTTAATATTTCATAACAGAAGAATATTAAAAAATAAGAAATGGAAAATG
AAGTTCGGTATGCTAACAGATGAGTGCAGTAATAAGTCAATTCTTCAACTTTACTATTAT
CCACTTTTTATTTACCAAAGATTATTTATTGCTGGAATCATTGTTTACGTTTATGATATG
CCTTTCCTTTAATGTATCCTGGTAATGGTATGTAACGCAGCAATGATAGTATACTTAGTA
GTTATTAGACCCTTTAAAGAAGAAATTTAACAAACTACAACTGTTCTTGATGAAATTATA
ATTATGGTATGTGTAGGCCTATTTATAAATCTTTATCAAGGCGGAGCTTATATGGATTCT
AATTAAAAAAAGAATTATGGGTGGGGAATAATTGCTTTGATTATGTTTAGCGTTTGCAAA
AATTTTGGAGTAGTTATCTACTTTGGAGTTCAAAAAACATAAGAAAAATTAAGGAAAATG
TTTTCAGCTGATGATTAGTTAAAGGACTCTCCCCAAACCAGTGATGAAGATGACATGCTT
GAAGAAAATGATATGATGAACGATTTTGATACAAAAGAAATTCTAGAAGAAATTGAGCAA
GAAATATAGGCCGAAAAGAAGTCCAATGACAAAAAATGA


>Contig9075.0.g84(protein)
MNIDFPNNVQTFSGYLKVASGDIEEKQQYVTNIADYIINIKHVERPMDNEKLQQKFIDDE
VPPYFIVAFGLKLTFRCLGFLIILPFSLILNKLCKKVKLWEEIIGAFFFNLPLRTFIEMY
IELILQVVINTQFIKFKNIDQMITTLIAFIFGAISLLLPSMGMTLIFHNRRILKNKKWKM
KFGMLTDECSNKSILQLYYYPLFIYQRLFIAGIIVYVYDMPFLQCILVMVCNAAMIVYLV
VIRPFKEEIQQTTTVLDEIIIMVCVGLFINLYQGGAYMDSNQKKNYGWGIIALIMFSVCK
NFGVVIYFGVQKTQEKLRKMFSADDQLKDSPQTSDEDDMLEENDMMNDFDTKEILEEIEQ
EIQAEKKSNDKK