Identifiers and Description

Gene Model Identifier

Contig8426.0.0.g23

Standard Name

LSF1x

Aliases

Contig8426_0_0_g23

Description

Mycolic acid cyclopropane synthetase

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( pfam02353 ) Mycolic acid cyclopropane synthetase
  • ( pfam03143 ) Elongation factor Tu C-terminal domain

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig8426.0.0.g23(coding)
ATGGTATGTGTGGGAGTATTCCTTCTAATTTACAGATCAAAATTAGGCCCTGATGAGTTA
AAAGAATATGGGTGGGGTATCGTAATTTTGATTCTATTCAGTGTTATAAAGAACTTCAGT
GTGGTTATATATTTCGGAGTTTTGTAAGCGAGAAAGAAAATTAAGCAAATGTTCTAAGAA
GAAGATCTTCAAAAAGATTCCCCTCATACAAGCGATGATGAATATGATTAAGTAAACGAG
TAAGACGAAAACTTCAATACACTTGAGTTGATTGAAGAAATAAAAATAGAAAATCAAAAT
AGATTTGCAAACTTGGATAATACTCGGTACTAATCTAATATTAATCACACTATTAATTAT
TCCACATATAAACAATGA


>Contig8426.0.0.g23(protein)
MVCVGVFLLIYRSKLGPDELKEYGWGIVILILFSVIKNFSVVIYFGVLQARKKIKQMFQE
EDLQKDSPHTSDDEYDQVNEQDENFNTLELIEEIKIENQNRFANLDNTRYQSNINHTINY
STYKQ