Identifiers and Description

Gene Model Identifier

Contig978.1.g48

Standard Name

LSF1u

Aliases

Contig978_1_g48

Description

Domain of unknown function (DUF4215)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13948 ) Domain of unknown function (DUF4215)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003134108.003613776907505e-34hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig978.1.g48(coding)
ATGAGTTTCTTGGATGTTTGGAGTCCTCTGTCAACTTGTCTGATATAAGTAACACCAACA
AATGAAACTAGCATTTTCACAATATTCTTGAAGGAGTTATAAATACACTCAATGCTTGTA
CCCTATAAATCTTTCCTACTAAAAATGAATTTAGCAACAAAATCTAAACAAACTCCAGCG
ATGATTGTTCAATTAAAAATGGATGAAATGTCAGGAGACAGAATATATAATCATGCCGAT
AACTAAGCTTTATCTTTCACTTTTATAGATATTCCTGATATTGAGTGGGTTTACTACAGG
GAAACTATTGACTCTGGGTCTAGTTAATACAGTACAGAAATTAAATATATGAAATGTAAC
AAAGAAAATTATACTTATGTAGGAGATCATTGTGAATATTATGAGTGTGCAAGTGAATGT
TATGCTAATCAACGAGTTGGTCATTGTACAGGATGGACTAATACTGAGTGTGCATTTTTG
AATCCAAATGGTACAGGAATAGTTTATGACCCAACTTACAATGATTACCTTGCTTGCTAT
AGATATTGCACTTCTTGCGAAGTCCCTTATTTAAACACTCGTTGCTCTGGCTGTGTTTCT
GGTACTTATAGTTACACAGATATAAAGAAATTATATGCAGTTGCAAACAACAGTTGTTTT
GAATTCTGCCCAGATTCCACATTTTTAAATTAAACGACTTAAAACTGTGAAGATTGTCCA
AACTATTGCAAGTGTGATCCTCTTGAACCTAAAACATGCTTATCTTGTATGAATAGCACT
TTTCTCTTTGATAAAGTAAGAAATGTTTGTTTGATTACTTGTCCATTTTAAACCCTCTAC
AATAATGATTCTCAAACTTGTGAGAGTTGCAGCTCAGATTGCACTGGATGTAAAGGATTT
ACTTAGTATGATTGTACAGGATGTGTCGGTGATAAGGTTCTTTTTACTTTGCCAAATAAA
AAAACTATTTGTGTTGATAAATCTTGTAAAGATGGGAATTATTTCGATAATAATACAGGC
TCTTGTGAAACATGTCATTAAGCATGTGATACTTGCAGTGGTCCAAATGTTGAAGATTGC
AAAACTTGTGCTTATTCTTATCAAATTTACTCGAATGAATGCAAAAGTTGCTCTGAAATA
AATTCACTAGATGATAAATATAATGGTCAATTTAACACAAAGAAAGAAGTTTGCTCTGAA
GTTTGTGGGGATGGTTTCCGAATAGGCGTTGATGCATGTGATGATGGAAATTTAGATGAT
GGCGATGGCTGCAGTTCACTATGCACAATAGAGAGAGGTTTTGGTTGTAAAGGGGGTTCG
TCAACAACCCCAGATGTTTGTTACAGTACAAAAACAACTTCATTTTCTGCAGTTATATAA
GCACAGTCTTCAAGTTCTGCTAATGGAATTGTCAATGTTAAGTTTTCTGAAAATGTATAT
TTCAACGACAATTATCAGGATACCTACAAAAACTATATACTTTTTGGTGTAGTTGGGAGT
TCTAAAGGAAATTATCCCTTAAACTATGAAGTAACTATAATGAAAGATCCAGCTACAAAA
TCTGATTATATCAGAATTAAGTATAATGCTTTCTTTGATAATTCTGGTTCCAACTTAAAA
TTCAATGTCACCATAACTGTTGATGACATGTTTTAGACAAAGTTTTTCACAAAAGTTATG
AGAAATTCTCAGCTTGTTGATATCCCTTATTTTACTAGAGAATCTGAGGGAACTGCTTCA
ATTAGTTCTGTGATGGATGGAGTTCAGACAATAATGTTGGCATTCTTGATCACTAATCTG
GCCTTATCAGTTATTCTTGGGGATGGTCTACAGCACATGTGGAATTTGATTAACTATCTA
CAATTACTATATTTCCTGCCTCTTATAAATGTGAATTTCCATGAGTTATCTTAAACTGTA
TTCCAACTCTTGGCTTTTGTGACAGCTGATTTCTTCTCGTTTGTTCCCCAAGGTTTTGGA
CTTATATTGAATTTAAATGATCTAGATGAAAGACAGTACAACGAAAGATTTACAAATTTG
AACTTTGAAGGAGTGCTTTTGATCAGCAATTACTATTAGAAATTGGAAGTTTTTATTATT
CTATTCTGTATATACCCAATCTTTTTAATTGGCAAAAAGATAAACAATCGAATACTATCC
ATGCCCTTCAAGTATTTATATGGAACTATGACTTTCAATTTTCCTATGTAATTTTTTACA
GAGATGTATTTAGAATTAGCAGTGACTATTTGGCTAAATATGTATGCTGGCATTCAGTTT
GATAATTATTCTCAGTATATGGCAACTGGAATAGCTGTAATAGTGTTCATAATTGTTTCT
GTATATCCAATCTTAGTTTATTCAATTATTATGACAAACTTTGACAAACTCTCACTCCAT
TCTTTCCATGCTAAATTTGGCGCTACAGTAGAATGCATTAGATATAAACTAAATTCCACT
CTTACCTAGATGTGGATACCTTTGTTCTTATTTAGAAGATATACATATAGTGCTATTTTA
GTTGTGCTTGATTAGCCTGTCCTTCAGATAATGCTATGTATTTCTCAATCTGTTATGACT
TTGATATTTATGTTGAGGACCAAGCCTTTTGATAGTTGGGATTTAAATCTATTGTTTGTT
GTTAATGAACTTACAATCTTGATAAGTTTCGTTATAACTACCTGCTTCATGATGGATTAT
AGTGACGATGAAGGAAAAATGATTTCTTGGGCTTTGATAAGTGTTATGGGCTTAGATGTT
GTCACTAATCTGGGTTTCGTGATATACGATTTATATGCAAAATTTAAGAAACTTTTCATC
AAAATTAAACTAAGATACCAGATATATCAAAGAAAGAAGAACAACTTGCCTTATGATGAC
TTAACTAAACTTTTGTATCCTGAAAAGTCTTAAAATGCCAACCATAATTAAAGTGAAGAG
ACAAAGAGACTTAAAAGGAATGAGAATCAAAAGCAAAAGGGTAGTAAAGACTTAAAATTA
TCAGAATTCAATCACTCACAGATCAATTTAGTTGATGCTGATTGTTCTCCAGACAACAAA
TCAAAGCCGATGTTCACAGAAAAAAATGAGGATATATTTGTATCTTTAAAACAAATTTCA
CATTTGAAAAGAAAGCAAAGTTTATAAGCTAAAGCCAAAAAGAAACTCGATGAAGAAATT
AAAGTAGCAGAAATTCAGAAAAAGAAAAAATTATAAGCTAAAAATTAACTTCCAATAGAT
ATTCAACCTACTATAGGTCCATCTAATCCTAGCCATACCGTAATTAATAATAGAAGTCGT
AGGCTTTTTAATTTCCCCTCAACTCAAATTTCAATTAACAATCAAGAGGACACTCCAAAC
TTGCATGACCTCTCTAACATGCAATCATTTTTCTACAATGATATCACTGCTAACCATGAA
TTGCTTAATGATCAAACAATCCATGTCTTAGAACACGAGAATGAAGATTTATAATAAGAT
GAACTCGTATAAAACTTCCGAAGCCAGTTAACAGAGTTTGACTTATCAAACATGCCAAAG
GATTCGCAATAATCATAAGTACCAGTTGTTATAAATATATTTAACATTGGGCAAATTAAA
AATAAAAATCAGTCAAAAACATTGGCAAGTTTTGGGGATGGATGTAAGAAAAGCAAAAAG
AAAGGTAAAAAGAGTGGGAATAGTGGTGGAAGATAAGCCAACTCTTAGAATAATTTCAAT
AGCAATCAGCAAATATTTACGGATAGTGTAGTTAACGCTAGAGTTGAATAGCAATCAGAG
GTATTCTTTAAGCTCGATGAAGACAATCTAGATAACATGCTGGACAGAATAATCCAACAA
CCTCAAAACCAATAAAATCAATAACAAAACCTTCGATTGAACAGTGAGCAAAATAGCCAC
ACATTAACTGATACTTTCAAATCAGGCACAATGACTTCTCTCTTGAATTAAAATGATAAA
TCTACTCCTCTATAATAATAGCATCAGCCTAGATCAAATACTTTGTTAAATAACAGAAGA
GAAAATAGAAGCGGCTAGATTGGTGGCACTTTCACTAACCTAAACACAAAATTGAGTGAG
ATAAATAAAGCTCCTAAAACAAACAATTTCACAGATGCTTTTGAAGAGTAGAAAGTAGGA
CCAGGTAAATAGAAGAAATCAGCAACATTTGTCGAAAATAATCAACAAAAGAAGAAAGAC
AAAAAGATAAAAAGGGATAAGAAAAAACAAGATAGTGATGATGATGAAGATCCATTCTCT
GCTTTTGCTCCTAAATTTACAGGATTTAATTCAAAATTCTGA


>Contig978.1.g48(protein)
MSFLDVWSPLSTCLIQVTPTNETSIFTIFLKELQIHSMLVPYKSFLLKMNLATKSKQTPA
MIVQLKMDEMSGDRIYNHADNQALSFTFIDIPDIEWVYYRETIDSGSSQYSTEIKYMKCN
KENYTYVGDHCEYYECASECYANQRVGHCTGWTNTECAFLNPNGTGIVYDPTYNDYLACY
RYCTSCEVPYLNTRCSGCVSGTYSYTDIKKLYAVANNSCFEFCPDSTFLNQTTQNCEDCP
NYCKCDPLEPKTCLSCMNSTFLFDKVRNVCLITCPFQTLYNNDSQTCESCSSDCTGCKGF
TQYDCTGCVGDKVLFTLPNKKTICVDKSCKDGNYFDNNTGSCETCHQACDTCSGPNVEDC
KTCAYSYQIYSNECKSCSEINSLDDKYNGQFNTKKEVCSEVCGDGFRIGVDACDDGNLDD
GDGCSSLCTIERGFGCKGGSSTTPDVCYSTKTTSFSAVIQAQSSSSANGIVNVKFSENVY
FNDNYQDTYKNYILFGVVGSSKGNYPLNYEVTIMKDPATKSDYIRIKYNAFFDNSGSNLK
FNVTITVDDMFQTKFFTKVMRNSQLVDIPYFTRESEGTASISSVMDGVQTIMLAFLITNL
ALSVILGDGLQHMWNLINYLQLLYFLPLINVNFHELSQTVFQLLAFVTADFFSFVPQGFG
LILNLNDLDERQYNERFTNLNFEGVLLISNYYQKLEVFIILFCIYPIFLIGKKINNRILS
MPFKYLYGTMTFNFPMQFFTEMYLELAVTIWLNMYAGIQFDNYSQYMATGIAVIVFIIVS
VYPILVYSIIMTNFDKLSLHSFHAKFGATVECIRYKLNSTLTQMWIPLFLFRRYTYSAIL
VVLDQPVLQIMLCISQSVMTLIFMLRTKPFDSWDLNLLFVVNELTILISFVITTCFMMDY
SDDEGKMISWALISVMGLDVVTNLGFVIYDLYAKFKKLFIKIKLRYQIYQRKKNNLPYDD
LTKLLYPEKSQNANHNQSEETKRLKRNENQKQKGSKDLKLSEFNHSQINLVDADCSPDNK
SKPMFTEKNEDIFVSLKQISHLKRKQSLQAKAKKKLDEEIKVAEIQKKKKLQAKNQLPID
IQPTIGPSNPSHTVINNRSRRLFNFPSTQISINNQEDTPNLHDLSNMQSFFYNDITANHE
LLNDQTIHVLEHENEDLQQDELVQNFRSQLTEFDLSNMPKDSQQSQVPVVINIFNIGQIK
NKNQSKTLASFGDGCKKSKKKGKKSGNSGGRQANSQNNFNSNQQIFTDSVVNARVEQQSE
VFFKLDEDNLDNMLDRIIQQPQNQQNQQQNLRLNSEQNSHTLTDTFKSGTMTSLLNQNDK
STPLQQQHQPRSNTLLNNRRENRSGQIGGTFTNLNTKLSEINKAPKTNNFTDAFEEQKVG
PGKQKKSATFVENNQQKKKDKKIKRDKKKQDSDDDEDPFSAFAPKFTGFNSKF