Identifiers and Description

Gene Model Identifier

Contig19295.0.g22

Standard Name

LSF1r

Aliases

Contig19295_0_g22

Description

Ctr copper transporter family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003185309.995317835403734e-19La domain containing protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig19295.0.g22(coding)
ATGAACGAGTATAATAGCAATTAGCCACTACACCAAAATGTGAACAGAAATCATGATGAA
GATGATACTATCCAAACTGCAGTTGATGATGGTGTTTACCAAAACACCTTCAGGGAAGAT
AACACTTAAAGAAGCATGATGAAGTCAACTCTAAACAATGATATGCTTATGAGTTCATAA
AGGGAATTTCTCAGATCTAGTGTCATTGAAAGGATAGAAGATAGTGACAGCAAAATGCCA
AACTTTGAAGAAGGTATTGAAGTGATATTGGAAGAAGACTCAATTGATTATAATTAGCAA
AATAAAAATAAAAACAACTTATCCATCAACGCAGGCAAAAAGAAAAATAAATAGATTAAG
AGAGATTTGAAGGAAAATAGTTCAACAAATGATCAGTTTACTACAAATGAAGTGATGACT
ATTTCAAATGTATAAACCGAAAGCGCTTTACAACACCATAAAAATAAAACATCAAAACAC
ACACTGCAATCCTCTCATAATACTAATTAATAGGATGAAGATTAAGAATTATAAGAAAAT
GGAGTGGAAGATGCTTAAAATTAGAACGACATTAGCTATGTGGAAGAATAGTGGTTGCAA
AGCAGGGCTGCCACAGTTACTAGTATGATATTTAAAGCAGTATGCTCTACTATTTCATTT
CTTAACTTGATATTGTTGATACTTTATGTGAGTAAAGAAAAATTCGCAACATACTAACTT
TATCAGAGTTATGTGGGGTTAGTCGTTTTTAGGCCATTTGCACTTTTGATCCTAGGAATT
TTCCTAGCGCTTATTCGATAAATGAGAAAAAGATAACAACTATATAAAGAGTAATAAGAG
AGGATTCAATTGCCAACTGATTCCCAAAGATCCACTACCATTAATTAATAAGATTTTACT
TTATCGATTAGCATCAAAGAATAAGTAGTGGATGAAGATGAGAGTAAAACTTCATCAAAT
AAAGTTGGACTTATCAAAAGGAGTCTCTTTTTCATAACTTAATACTTCATCACTTATTTT
GGGTTCTTTAGATTTTTATCGATGTCTTAACAAACTAATCAAGTAGTTCTGGCTTATTTA
ATGGAGCTATTTCTACAAATAATTTCAATATTATATTTACAAGTAAAAAATACTAGTACT
AATAACGTAAGAAATGTCAGTGATTTGAGTGATTTATCAATTGCAATTATGGTTATAAAT
ATTGTAGTAATCATGATTGAACTAGTGTTGCTTGTGTTTAAATATTAAAGAGTAAAAAAG
TATAGAAAAGATCATGAACTCACTATAAAAGCAGCTAAGAAAAGATAGTATTAGGAGTAG
GTTAAAAAGACATAGACAGGTTTGGGAGAAGCTAGAAAAATCACTATCCCTGGACCTTTT
TAAAAGAGTACAAATGAGATAGTTCTGATGTATTTCAAAAGAAACATTCTACTTAGTCTT
GGATTAATCAGCATCTTCATTTTGATAATCATATCTTTAGAATTCAGTCTATCAGGAATG
GGATGCCCACCAAAAGAGGGTTTTAGAGGCAATACTTGTGAACCTTGCACAGATAACAAT
TGCATTATGTGTAGCTAAAATTACGGGCAGTGTCAATAGTGTAATTTAGGCTATTATAAA
GATGCAAACTATGAATGTTAGCAGTGTAACACTTCTGGCTGCGTAATGTGTGATGCTAAA
GACACTTGTTCTTTATGTCAAACAGGTTACAGACTATAAAACAGTAAATGTATCCTTTGT
GACATGACTGCAAATTGTGCTGAGTGTAACAGCCAGAAATGCATTGCATGTTTACCAGGG
TATTATTTTGATGAGAGTGAGATTCAATGCTTGAAATGCTCAGACAAGTTAGCATACTGT
GATGAATGCAATAATGGCGATCAGTGTTAAAGTTGCAGACCAGGAATAGCTATAAATTCA
AATGGTAAGTGTGAGTGCGACAGTTAACATGGATGGGAAACTATAAATTTAACTCAGTCA
ACCTTTGTATGTAAATGCAATGATTATGTTATGTCTTCTACAAACAGGTGCTATTCTTGT
GATTCAATAATTAGTGGATGTGGTAAATGCACTAATACAGATGAATTTAAGGAGAGTGTG
AGATACTTAGGACTAACAGACTATAAACCAACTCAAAAAAAATACCTTTAATGTGATAGT
TGCATAGATAGCTACTTCTATAATAATGATTAAAGTAGATGTGAATAATGTGCTTTTGCT
ATAAATAATTGTAACTCCTGCGATGGACCAAGTAAGTGCAAGAAATGTTTGGAAGGGTTT
TATTTGGACACCAAAACTGGTGATAAGAATCAGTAATGTGTTTAATGCTTGACATAAATT
GATAATTGCTAAAGATGTGCAGGAAAAGATTCATGTATCTAATGTATGGATGGATTCATA
ATAAATCAAAATGGATAATGTGTTTGA


>Contig19295.0.g22(protein)
MNEYNSNQPLHQNVNRNHDEDDTIQTAVDDGVYQNTFREDNTQRSMMKSTLNNDMLMSSQ
REFLRSSVIERIEDSDSKMPNFEEGIEVILEEDSIDYNQQNKNKNNLSINAGKKKNKQIK
RDLKENSSTNDQFTTNEVMTISNVQTESALQHHKNKTSKHTLQSSHNTNQQDEDQELQEN
GVEDAQNQNDISYVEEQWLQSRAATVTSMIFKAVCSTISFLNLILLILYVSKEKFATYQL
YQSYVGLVVFRPFALLILGIFLALIRQMRKRQQLYKEQQERIQLPTDSQRSTTINQQDFT
LSISIKEQVVDEDESKTSSNKVGLIKRSLFFITQYFITYFGFFRFLSMSQQTNQVVLAYL
MELFLQIISILYLQVKNTSTNNVRNVSDLSDLSIAIMVINIVVIMIELVLLVFKYQRVKK
YRKDHELTIKAAKKRQYQEQVKKTQTGLGEARKITIPGPFQKSTNEIVLMYFKRNILLSL
GLISIFILIIISLEFSLSGMGCPPKEGFRGNTCEPCTDNNCIMCSQNYGQCQQCNLGYYK
DANYECQQCNTSGCVMCDAKDTCSLCQTGYRLQNSKCILCDMTANCAECNSQKCIACLPG
YYFDESEIQCLKCSDKLAYCDECNNGDQCQSCRPGIAINSNGKCECDSQHGWETINLTQS
TFVCKCNDYVMSSTNRCYSCDSIISGCGKCTNTDEFKESVRYLGLTDYKPTQKKYLQCDS
CIDSYFYNNDQSRCEQCAFAINNCNSCDGPSKCKKCLEGFYLDTKTGDKNQQCVQCLTQI
DNCQRCAGKDSCIQCMDGFIINQNGQCV