Identifiers and Description

Gene Model Identifier

Contig309.0.g68

Standard Name

LSF1q

Aliases

Contig309_0_g68

Description

Giardia variant-specific surface protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( pfam03302 ) Giardia variant-specific surface protein
  • ( pfam08374 ) Protocadherin
  • ( pfam13882 ) C-terminal domain of Fibronectin type III
  • ( pfam08496 ) Peptidase family S49 N-terminal

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_005868107.002411919958887e-50zinc finger domain, LSD1 subcl
ass family protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig309.0.g68(coding)
ATGATTACTTAAGCATAGCCACCAGATCACTACTGGGATTTTAGTAAAAGTTCAAATGTT
AATGGAAACGATTATGTTTTCGATTAAATGACTAAAGATGACAAATACTCTTTTGGTTAT
ATTCCTGACAGAGTTGGATTGTGCGACAAAACTGGTTCTAAAAGGCCTGAAAAAGGTGCT
GATGGAATGTTTTTTAGTTAATATGAGTCATCAATGAGGATTGAAAATGGAGGAGCTAAC
CTACTTTTAGGAAGTAAATTCTAGATAGCTGTTTGGGTTAAATTTCACAATTACTTCAGC
CCATCAAATATAAATTAATATACGATTTTAACATAAAAAAGATATGATGCAAATTGGTAT
AATTCGTACTCCTTATACTTGAATTACAACTCTTATAACGGTTAAACTCAATTCGGGTAT
TCATAACTGGTAACTCACTCATCAAATTCTTATTCGTATGCTTTATTTGAATACACTGTC
TAAACTAATACCACTATAACCAGTGGGTGGCATCTATTTTCAGTATCTTAAGATTCTGCT
TACTAACAATCAAATGTAACATTGCGCATCAGATCGCCAAATGGTGCTTATGATAATGCC
AATATGGTCTATAGTCCAGGGTACTCATACAATGAGACAAATGCTTATAATTATCTTTCA
GATATCTATGTAGGAGCACACTGTATTCCATAACAAGATAATGGCTACTACTATAAAAAT
CTAGCAATAACAATTGGAAGAATTTATATTTGGAAAAATTTTGCAAATCTAATGCAACAT
TCAAGTTTTGATAGATTCTTCTTTAGAAACAGTGGGAATTATGCAGCAACTACGATCTAA
ATGCCCTAATGCCTGGGTCCTGTCAGTCCATGCAGTATTTGTGTAGTCGATTATCCTTTT
CCTCTTTTGAATTTAATGCCGTTGAATTGTTCAAGCCAAAATTCTGACTTAAGTTAAATG
TTCATTGCATATTGGGACTTCGATGACCCAGATCCCACGAATACAATGACAAATTAATAT
GTATAAGATAAGAGTGGTAATAATTATCATTTGTCCAAAATGAATGTTGATGATGTGGAA
TCTAACGAGATCTATAGAGTTTTAGGATAAGGACTAATGATTGTAGGCGATTGGGTTTAT
TTTACATCAGTTCAACTAATTCCCGTGAAGTTTCACAATTAGTTTACTGTTGAAGTCTGG
CTTAAGAGAGTTATGGATGGGGCTACAGGTAACAGTAATGTGGCCGGTTTCACTGCTATT
CCATTTTGGGTAATGGAAGGTGGAAACAATATTGTTTAATGGACTTTATCAGAACAATGG
GGGAAATCAACAGTATGTTTTGATGATAATTGTAATTAGAGATCTGATATGGCTATTACT
AATTTCTTAACTACTGAAAAATGGCATTTTGCATCACTAGCAGTTTCAGCATACACTCTC
TGGCAAAACGGATGGGGAGTTCATTTCAGGCACTAATGCGATGGTCAAGCTTAACTAGAT
CCTAGAGGATAATTTGGACAAAATCCATTAAGATTTACTAACTCATCCAAGTTCATGGTT
GGTGCTTTCAAATCTGTTATATATAAATCTCTCAAAATATACAACTTCGCGAAATTTGTC
GATGAAGGCAGGGTGGCATATATTAATAATGCAGCTGGCTGTACAAAACTAGGTAATTAA
GCCTAGTGTAGTTAATGTCCAGCGGAAACTAAGACATGCTTGAGTATGTGTAAATTGAAT
GAATATGGAGAAAATTGTGACAAATGTCACTCTTTCTGCGGAATGTGTGATGGACCTACA
AAAGATGACTGTATCATATGTGCTAGAACTGTGTCTCCAGCAAATGTTTTCTATAGTTAA
ACTTTTGGAAATTGCACTTGTGTTTCCGGCATGTACTACAAGTCATCAACTGACAAATGC
GAAGTATGTGACTCTGCATGCCAAGAATGTTTTGGACCAACAAACAAAGAATGCTTGACT
TGCAAGCCAACCAAAATATTTCATCCCGGTACTAATTGTGTTAATGATTGTACAGATCCC
ATCGTAGTGGGGACATCAACTTAAGGTTATTACAATAAATCAGAAACCATCTAAGGAACT
GCTACTTAAGTATGTGCGAAATGTCATCCATATTGCAGTAAGTGCAATGGTCCATTAAGT
AACAATTGCTAAGCATGTCATAATGGATTTTTTCTTCAATCTACTAGTGTGTGCTATGCT
ACTTGTCCTGATGGGTAATATCCTGATAGCACTACAAATAAATGTGTAGCTTGTCACACA
GACTGCAAGACATGCACAGCAGGAGCCAACAGCAATTGCCTTACTTGCACTGATCCTTTA
AAAGTCCAGCAGGATGGAAAGTGCTAAGCCAAATGCAATGATGGTTACTTTGCTGATGCT
TCAAAAGTGTGTGGAACATGTAATGCTGCGTGTGCAACTTGTACCTCTAGACTTGCGTCA
GACTGTCAATCGTGTAACAACAATTACTATTTGGAATGGTTGGGAACTACTTGTAAGAGC
ACCTGTAAAGATGGCACATACGCTGATACTAATACTAACCAATGCCTTATGTGTCACTAT
TCTTGTGAGACCTGCAGTGGTGGAGGAGGTCCAGATAAATGTACGAAGTGTGCAGCAGGT
TTCTTGAAGCGCGGCAGTTTTTGTGTGACAGCTTGCGCAGACAGTGAATATGAGATAAAT
GGCGCTTGTGTGACTTGCGACTCTAAATGCTCAACTTGCTATGGAACAAGAAATGATCAG
TGCTACACATGTGCAGAAAACTCAATTACAGGAATAGGTTATTTCTATTTCAATGACTCC
TGTTTAGAGAAGTGTCCAGATGGATATTATCAGGACAATTTGAGACGTATCTGCAAGAAA
TGCAACCCAAGATGTGCGACATGCATTAGTGATACTTTCTGCACTAGCTGTATTTACGGC
CCTTATTAGCTAAATAACGGAGAGTGTACATTTTTCACTTGCTTGGATACACAGTATAGA
GCCATTAAACCACAACTGGCGTGTTATGAGTGCGATTCTTCCTGCTTGACATGTCAAGGA
GAGAGCAAATTCGATTGTTTAACTTGTAAACCATAAAACTAATTCCAAGCACAACAATGT
ATGTCGTGTAGTTAGTAGCCTGGAATGACTGATCCACTTGACGAAACCCCTGGTTGTGTT
GAAATCTGTGGTGATGGCTTCAACTACGGGTTCTTCCAGTGCGACGATGGAAACGTGATT
AATGGAGACGGATGCTCAAGTAAGTGCACTATTGAGAGTGGGTTTAACTGCACCACAGGC
TCGAAGTTAGCGCCCAGTGTATGCATGGACAATAAAAATCCTACTCCAAAGATCAGTCTT
GTTTCATCCAAGAATTTCATCTACATCGAATTTGATGAGGAAGTTCAGCTGTAAAAAGCA
CTTGATGAGACCAACGTTAAAATCACTATCACGGGTCCATAATCGTCTTACAAGTTTGAC
TGGCGTTTAGCTGATGACTACAAGACCTCAGAACCAGTGTAGATGGCAGTTATAGAACTT
AGTATGTACTCATCACTCAAAGGAGATAGTAAGGAGCAGGTTATTATATAATTCCTCACC
GATCAAATTTACAAAGACCCAACTGGAAACGGAATAATAACAGTACCACTGTATTCTTAC
TTAAACAAATATGAGTACATCGATCCCGAGACAAAGGCCAAACTTGATGCTGCAGGAGAC
ACCTCAATGCTAGCCACATTTGGTGCTGTAGCCATTAACCTGGTTATATCTCAGTTATTT
GGTGGAAGTATTGCAGCTATGTGGACAATGGTCAACACTATCCAATTGATAAGTCTGCTA
CCTCTGTGTAATGTCAATTTCCCTAAGATCACAGTAATGGTACTTGAGAAGATGCTCACT
TCTCACGGTGAGTCCACAATAATCCCGAATGTCTTCTATACTTTTCTGATCAATCGCAGT
GGCTCCGCAGTTAAGGTAGAACCAGCACTCAATGAGAGATTTAGTGACTACGGTTGGACT
GTTAGTAATTTCCTATATCTCTCCGGGAGAAAGATTTTACTCTGGACTCTAATTATCTTC
GCTTATCCATTTGTGTGGTATATGAAACGTAAATACGCAGATAAACACAAGCTGTGCTAA
ATGTGGGTGAAAGCTGAGCAGAAATTCCGGTATACTTTACTGTTAAGAGGTGTGATTATG
TCATATGTGTCCATGTACTTAGCTTTTATCTTGGGTATCTTCTAGATGGACCTCACAACT
ATGGAGAATACTATCTCCGCTTTCTCTGCTATAGCTTTTGGTATTATCCTGACATACTTG
CCGGTGCTGCTGATGAATATCCTTTAGAGAAATTACGAGAAAATTCAGACCGACAAGTTT
ATGATTTCCTACTCCACAATCGTAAAGGAGGTGGATCTCTCTCACCCAATCAGATACATG
TACTACCCCGTGTTCCTAATGAGAAGAGCGCTGTTCGCTATTTCACTTGTGCTCTTTGCA
AACAATCCCGTATAGTAAATTGGTTTCATGAGTGCCACTGCTTTTGTGATGATTATCTAT
GTATGTGTGATCAAACCACAAAAAGAAAAAGTGATGATTATCTTGACAGCATTTGGTGAG
GGTGTCTTATTGTTCCTGCATTTGTACTCAATCCTATTTCTGGATGAAGATCTACCTGAA
GAGAAATCTAATTCCTACGGTTGGTTCATGATATGCATCATCGGGCTCTACATCCTCACC
AACTGGGTAGTAATCATAGTAATAACAGTGAAGCAGTTGAAACAAAAATGGGCTGACTAT
AAGAAAAGCAAAGTGGATGTGAAAAAGAAGGCGGAGGAAGACAAAGAGTACAAGAAATGG
AAAAAGAAGCGACACATCAGGAGACAGATGGAGCAGGAACAAGAGAAACAGCAAATGCTT
GAGATATTGGACGATGAAACTAGGAAAAACCAGAGAAGCAACGGAGATGTGCAAGTGACA
ATTCCAAATTTCATGCAAGGACCGTAGCATTACTCTCCTTCTCCCTTCTCCCCGACTCCT
TATTCACCGTACTCTCCTTACACTCCTAATAACGGAATGTTAGATCCTGATGGGACAATT
GCTATGTTTCCACCAATGAATGATATGAACGGCACTGGGTACAATCACATACCATCACTT
TCTGATATAAATGGAAACGCCAATGCCGGTGGTGACCCTATACTTGACGAACCACCATCT
CCAAATATCTTCGCCAGCAACAATAAATTCCTGCATGATTAGATTTCCGAATAGCAAAAA
CAAGCCTCCTTTAATATGAATAGAAGTGGGAGCGGCTAATCAGAAAGATATCAAAGCAGT
TTCACTCAGATCGGTCCAGGTGGTGGGTTTCCCCCTAATTCATCACTACGGTCTCCCGGT
ATCAAGCCAAAGATCGTTGATAGATACGCAAATGATGATAATTAGATCCTATTGACTGAT
AATTTTTCAGGACAGGGTATTAACAATAGACCATAGAGTAATGGAACTAATAATCCACTT
GATAATTGA


>Contig309.0.g68(protein)
MITQAQPPDHYWDFSKSSNVNGNDYVFDQMTKDDKYSFGYIPDRVGLCDKTGSKRPEKGA
DGMFFSQYESSMRIENGGANLLLGSKFQIAVWVKFHNYFSPSNINQYTILTQKRYDANWY
NSYSLYLNYNSYNGQTQFGYSQLVTHSSNSYSYALFEYTVQTNTTITSGWHLFSVSQDSA
YQQSNVTLRIRSPNGAYDNANMVYSPGYSYNETNAYNYLSDIYVGAHCIPQQDNGYYYKN
LAITIGRIYIWKNFANLMQHSSFDRFFFRNSGNYAATTIQMPQCLGPVSPCSICVVDYPF
PLLNLMPLNCSSQNSDLSQMFIAYWDFDDPDPTNTMTNQYVQDKSGNNYHLSKMNVDDVE
SNEIYRVLGQGLMIVGDWVYFTSVQLIPVKFHNQFTVEVWLKRVMDGATGNSNVAGFTAI
PFWVMEGGNNIVQWTLSEQWGKSTVCFDDNCNQRSDMAITNFLTTEKWHFASLAVSAYTL
WQNGWGVHFRHQCDGQAQLDPRGQFGQNPLRFTNSSKFMVGAFKSVIYKSLKIYNFAKFV
DEGRVAYINNAAGCTKLGNQAQCSQCPAETKTCLSMCKLNEYGENCDKCHSFCGMCDGPT
KDDCIICARTVSPANVFYSQTFGNCTCVSGMYYKSSTDKCEVCDSACQECFGPTNKECLT
CKPTKIFHPGTNCVNDCTDPIVVGTSTQGYYNKSETIQGTATQVCAKCHPYCSKCNGPLS
NNCQACHNGFFLQSTSVCYATCPDGQYPDSTTNKCVACHTDCKTCTAGANSNCLTCTDPL
KVQQDGKCQAKCNDGYFADASKVCGTCNAACATCTSRLASDCQSCNNNYYLEWLGTTCKS
TCKDGTYADTNTNQCLMCHYSCETCSGGGGPDKCTKCAAGFLKRGSFCVTACADSEYEIN
GACVTCDSKCSTCYGTRNDQCYTCAENSITGIGYFYFNDSCLEKCPDGYYQDNLRRICKK
CNPRCATCISDTFCTSCIYGPYQLNNGECTFFTCLDTQYRAIKPQLACYECDSSCLTCQG
ESKFDCLTCKPQNQFQAQQCMSCSQQPGMTDPLDETPGCVEICGDGFNYGFFQCDDGNVI
NGDGCSSKCTIESGFNCTTGSKLAPSVCMDNKNPTPKISLVSSKNFIYIEFDEEVQLQKA
LDETNVKITITGPQSSYKFDWRLADDYKTSEPVQMAVIELSMYSSLKGDSKEQVIIQFLT
DQIYKDPTGNGIITVPLYSYLNKYEYIDPETKAKLDAAGDTSMLATFGAVAINLVISQLF
GGSIAAMWTMVNTIQLISLLPLCNVNFPKITVMVLEKMLTSHGESTIIPNVFYTFLINRS
GSAVKVEPALNERFSDYGWTVSNFLYLSGRKILLWTLIIFAYPFVWYMKRKYADKHKLCQ
MWVKAEQKFRYTLLLRGVIMSYVSMYLAFILGIFQMDLTTMENTISAFSAIAFGIILTYL
PVLLMNILQRNYEKIQTDKFMISYSTIVKEVDLSHPIRYMYYPVFLMRRALFAISLVLFA
NNPVQQIGFMSATAFVMIIYVCVIKPQKEKVMIILTAFGEGVLLFLHLYSILFLDEDLPE
EKSNSYGWFMICIIGLYILTNWVVIIVITVKQLKQKWADYKKSKVDVKKKAEEDKEYKKW
KKKRHIRRQMEQEQEKQQMLEILDDETRKNQRSNGDVQVTIPNFMQGPQHYSPSPFSPTP
YSPYSPYTPNNGMLDPDGTIAMFPPMNDMNGTGYNHIPSLSDINGNANAGGDPILDEPPS
PNIFASNNKFLHDQISEQQKQASFNMNRSGSGQSERYQSSFTQIGPGGGFPPNSSLRSPG
IKPKIVDRYANDDNQILLTDNFSGQGINNRPQSNGTNNPLDN