Identifiers and Description

Gene Model Identifier

Contig21290.0.g83

Standard Name

LSF1p

Aliases

Contig21290_0_g83

Description

Concanavalin A-like lectin/glucanases superfamily

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Domains

  • ( pfam13385 ) Concanavalin A-like lectin/glucanases superfamily
  • ( pfam03302 ) Giardia variant-specific surface protein
  • ( pfam14316 ) Domain of unknown function (DUF4381)
  • ( pfam00122 ) E1-E2 ATPase

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010065301.9993430003514377e-39hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21290.0.g83(coding)
ATGCTGTTGTTTGTGATCAGCAGTATTAGATGCCAAACTGCGATTGTAGATGCTCCAGTG
AATAAAAGAGCATTATTTGTGAAATCTTCAACTGACTATTAATTTGCTTATAAGATTGAT
AGTCCACTTGACTTTATTTAAAATGATTACGGATTCTACACATATTGGTTTAGAATTGTT
GGATCTGAACTAAAAGATGGATATAGTATGTTTTAGTGGATAAATTACGATGATTACGTT
AACATCTGGTGGGTATAAGCGAAGAGATTAATGATTCTTCGACAAGACAGTTAGACCTAT
CTGTGCATGACTGAGTATGAAAATGTCGAAAATGCCAGATTGTAAATAAAAGATGGTTGG
AATCATACTGTTACATGGTACTTTTCGGTTAACATGCGAATTGTAACATACGATGGTGCA
TTTAGTAGCAATCATCCCTTTTACATATATTTCATGAGAAACATTTTATTCAAAGATTTA
TCTTCAACCATTAAAATGGGAGAGATGCAATTTTTTTACATTAAACCAGAAGAGCTCCCA
AAAATTAGAGATATCTTGGAGAGATATGTTGGATATCGATCAATTTACCAAAAGTATTTC
CCATCTGTCATGGACACCTACAGCTTAACATGGGGTAAAACATCATAGTACGACAACAAA
GGTAAATATCTAGACGCTAAATGGAAAGATTGGAAAGATAAAGACAGATTTCTTGATCTT
GTATCAGAGAGAGTTTGGTGGGATGAGGCAGAAAGCGCTTTGAATCTTTGTAATGCTACT
TAAAGATACAACTAGGGATCAAACATTTGCGTTGATTGTGAACTACCTTGCTTGGAATGC
AGTTTCTTCAGTGAATCTAAATGTTTCAGCTGTGTTGTAGGATACACTTTAGTGGGTTAT
AAATGTATACCATCAGATTGTCCAAGAGGATAGTACTTTGATTCTCCAAGTTAGACCTGC
AAAGTTTGTGTGGATCCTTGTTCTTCATGTTCCGATGCAACCAATTGCCTATATTGTGAC
ACAGGGTATCTCTATATTGATGATGGAAGTGGTGTTTGTGTTCCAAATACATAAGGATGT
TCTGCAGGCACTTATTTAGATCCTTCTGGATTACGCATATGTAAAAAATGCTCTTCAGGA
TGTAAAAATTGTGATTCTTAAATTAAATGCACATAATGCTAAAGCTAGTACTTATTGTAT
TAGGATTAGTGTTACATGGATTAGTGTCCAAGTGGATCAATGAATGATGGATTAGAAATT
TCTTGTTTGAATTGTGCAGATTCAAATTGTATTGCTTGCACTACTAAAGAGTGCTTACAA
TGTAAAAGTGGTACATTTTTAAGTAATAAAAAGTGTGAAACAAGCTGCCCAGATGGGTTT
TATGCTGATTCAACTTCTAGATCTTGTATGAAATGTCAAAGTGATTGTCTGAAATGTAGT
GGTAATAACTATACATGTTCATCTTGTAGTGCTTAAACCTATCTCTTCGGAACTTCTTGT
GTTAAGGAATGCCCCAAAAAATTGTACTTCCAAGATGAAGCAGCTAGAGAATGTAAATTA
TGTGATGTCAAATGCGAAATGTGCTCAAATAACAAAGATGACTGTGGTTAATGCTCTCAA
GGTAACTATCTCTATTAAAGAAAATGCGACTCAATCTGCCCAGTATCATTCTATTTGTAA
GAAGAAACTAGGATGTGTTATCCATGCCATTCTTTATGTCAAGATTGCTATGGCTCTCTT
AGTACTTAATGTACAAAGTGTGCTACTGGATTTTTCTTAAAAGAGACAACTTGTCTCGAT
GCTTGTCCACAACCCTATTTCACAGATAGCGTCTTGTAAATTTGTGATCTTTGCAAATAT
TTCTGTGATGAGTGTACGAGCGGTTAAAATTGCTAAGTATGTTTACCTGGATATTAGCCT
ATTCCAAATAATTGCTCGGGCGAATATTACTTAAGAGGAAAAAGTGAGAAATATCTTAGT
CTTCCTTACAATATAGATCAACTTGGCCCAGGTGAAGATCCAAAGTAAATGACTGTTGAA
ATTTGGTTTAAGCCAGAAAATATCTACAGTATCAATCTCGAAGTTATTTTAAGTTTAGGA
CCTTATAAGTTAAGAAAAAGACAAAATGAGGCTTCCATTCATTTATCCTATCAAGGCTAA
CTTGTTTACTGTGATACAGCCACTTCTAATAAACCACTCTATTCTTAATTGTGGTATCAT
TTCGCTTGGTCAATGGATGAAAACTTTTTGAGTCTTAAATGCTATCTGAATGGTGAATCT
ATAGGTGTAGGTACAAGTCCAACTCAGATAATAACTTAAAACATTCTTAGACCTTCTGAA
ATTATAATTGGTGGAACTGCAAATCCAAAGGTTCCAGAGACAAGCTTTAGAGGTTACTTT
AAAGAATTGAGAATTTGGAAAATATTAAGATCTGCTTTTTAGATAAATTACTTAAAGAAT
GTAGATGTTGCAAGTTGGGAAACGTTTATGTACGCTTACTGGAAGTTTGATGAAAAAAAT
GATGGAACTATCAAGTATTTCAAAGATAGCTCCTATAAAGGCTTGTAAAATTTCGATCCA
AAGACTGTTGATGCAACTTATACAGTTTAGAAAATTGTAGAAATGACTGAGATTGACTTG
AAAGTATGTAAAGAGGGATTTTATCCAGTATATGTTGATGAAGGGTCTTACTATACTTGT
TCTAAATGTAACACAGCTTGCAAGAATTGCAAAGGGCCTAACTCAAATGACTGTGTAGAG
TGCACTGAACCTTATAAACTTATTTAGGCTGAATTTATTTGCAAAATAATTGAAAGTTGC
CCTGAAGGTTAGTTCAAAGATTTAATTACTGGCTTGTGTGATACTTGTGATCCTGGGTGT
AAAACATGCATAGAGTCTGGTAGCTTCTGTTAATAATGCAGAGCTAACTATTTCAGAGAA
TTTCAAGGAACAAGTTGCGTTGACACATGCCCTTTTGGAATGTATGGAGATTACTAAAAG
CAAAATTGTTACTTTAACCCTTTGATAAGTTATATCACTCCTCTAAATGGAACAGTGTAT
AGTTATGGTACATTCATAGACTTAGAAAGCTAGTTTTCAGTATTGAACAATGAGCCAAAT
GATACTTATATTTATGGTTGGATCATTATGGATATGAGAAATTAAATTGATGTGTCCCAA
GATATAGTAAAGACATTTTATCAAAAAGATCAAACGAAAGTACATTTAGATCAAAATATT
ATTAGAGCTAATAGAGACTATAATATTACTTTCTATGTTTAAGGAGATTAGTAACGTTAC
AATAGATTGTACTCGACATCAACTAATTAAATTTATATTGGAAGTCCTCCTAAAAATGGT
AGATGTAGAGTTTCACCTATCATAGGTATTGCTTCAATTACTCCATTTATCATATCTTAG
TAAAATTGGTTAGATGAGGAACCTATTGAAAGATATGAATTTTCTTACTCGATAGATGGA
GGAGATATCTATATTCCAATGTCTGACGAGCTACTAACTAATCCAAACTTTACTTACACG
TTTGACTCAACTTATAACTAATATACAGAAGTAAAAATCAAATGCAAAGCTACCAATGCC
AGAGGTTTTTCCAATTAAGTTCTAAATACTATAAGTTTGGAAAAGCGTTCATCTGCTGAT
TCTTCTAAAGATTTAGAAGATCTACAATTGACTGCTTCACTCTCTGAAATTCAAGTTCTC
CAAAAGCTATAGCAAGTCAATTTGATTGCATAAAACCTAGGATAACTTAAAGTAAATGAT
CCTTTGTAATTTGATCCTAAGGTAGAAGTATTTTAGTGCACAGCTAGCACCTGTAATAAT
AGAGGCAATTGTACCTATCTTTATTACACAAAGAAGTATTATTGCTCTTGCAAGGCACCT
TTTGGGGGATAAAATTGCTCATTTGATGATGGGTCGTAAATTGATCTAATAAAGAAAACA
GTTTCAGACATCGCATCAATATATAATGGCATGTAGGATAAACAGTTTGAATTTGAATTT
CTCAAGTTGTCAACAACATACAAGGAAGTAATGAGTGAGTCAACCTATTAAATTATACTT
TCAATCATCACTTTTAAAGTACAATAGTGGAAAGATAAGCCATAGACTTAAGATGATTTG
AGCTCTTTCATGATAATTCTTTCAAACATGCTAGAGTTTATAGAATACGAACTTATAAAA
AACAATGTCACTAACTAGTGGAACTATGACTCACAGAATGCAATCGATATTTAGGAGCAC
ATCTAGTCGACACTCTCCTTGTTTGACAGAATCAGAGACAACTCGCTTAAGCAGCTATCT
ATGGTGACTACTTCCCAGCAATTTATTACCAGGATGGTAACATATAAGCAAATGCTTTTG
TCCTAAGAATCCTTAATGACTCTTTCAGCAAGCAACTTCACAAAGAAGAATCTGAGGACA
TTCATTAAACTATCGCCCTCTAATTTCTTAGGAGCTTCGTTTGATCTTGAGTAGTAATTT
GCGATTGAAGTTATTGAGTATGCCGTAAACCCCTATCAATTGCAAAATGTACAACACATT
TCGAATAATGTGTTCTCGGTTAAGATATACAACTCCTCTACCTTTGACGAAGTCAAGATT
AGCAATATGTAGAATGGATTTGAAATATATTTTCCCAATATTGATAGTTAAAATTTGACT
GATTTTGCAAAGGAATACAATAGTTTAAGTCCTTACAAAGCTGCTCAGAACTTAAAAAGA
ACGAAAATGTTAAACAGCAGCAGCCTTGCTTGCAATTATTGGAATGGTAATAAATGGGAA
AATTCAGGTTGCTTCTTTAATGGAATAGATAAAACACACATCAAATGTCTCTGCAATCAT
TTGACTTCATTTGCGCCATAATTCTTAACTCCTCCAGCTTATACAACCAAAGATGAGAGT
CTTCCTAATAAATATGAAAACTCAGAAAATATAGAAAAGGGAACTATTACAAAAAAAGAT
TTGCTTGTTCCTTTCAATAAATACTTTGATAATCTAGAAGAACTTCTGCAGCATAAGACC
CCTAAACCCATTGATTTGATCTTTAAGCCAGGCACTTATGTCGTGTTGATGTTCTGGTTC
ATGTACATCTCAAGTTTGGTGTACTATTCTGGGAGAGACAGAAGAAGACGAGGGAAGATG
ACTAAGAAGTAAATCAGAGAAGACTTGGCGGAGATCAAAGACAAAAGGATCCAGCAAGTC
CAAGAAGTAATGCAGGACTTGCTGCTAAGAGATGCCATGAATGCCAAAAAGAGACCTAAG
CAGAAATCTTCATAAAACCTGAATATGCACACTTCATTCGGAAAAATTAATGATGATAGC
ACAATTCTTGATGCTACATCTAAAACGCTAATTCATGACTAATCCTTTAGTTCACCTGAT
AACAGAAGGATTGCAGCTCAAAATCATAGAAGAATCTCAGCAATATTCAATTTAGGCTCC
ATAGGTCCTTAAAATGAAGCATCGGACACAGACTTAAGACTAAATCTTTCTTAGATTAAT
ACTGATAGTTAACAATAGTCTTTCACTTAAGTTCGTTAGCTTTCAGATTTATCTAAAGAT
GAACTGAAAGAATTAAAAAGAAGAGCAAAGCGTAAAGTGTTTGGAAGAGTAGGAACATTT
TCAGAGCGAGCTAATCGATTCTACAAGAGAACAAATAAAAGGCATAACCCATTTTAGAAC
AACAAAATGGAGTTCTTCAATGAAGCTCTAAAAGCTACTCTATGGATGGGGCTCCTAGCT
AAAACAAGCAAAATTGCTCCAAGACATGCTAGATTGGCGCTCTTGTACTTGTATATTTCT
GTACATTTGCTGATTACAAGCACTGCTTTTGTTCTCGGGTATATTGATACCTTTGCAGAA
ATGATTGGAGATTCTCTATTCTCAACTCTTGGTGCAGCCATATTGACTTTAATGGCAGCT
TGGGTAGTGTGCATTCCTGTAGCATTAATATTCAGAATGCCTATGAGTTTGAGGAGATAA
ATTGAAGGAGTGAGGACGAAAAAGATTAATGTGGTATTCAGAGAAATTGATGCATAAATG
AGTTGCAGATACGCTATAGGCTACTTTATCTGCTATTTGTTCTATTTGATGATGACAATT
GTTGTGACATTTTTCAACTTCTTCTATCCAAGTGATTACTGTATTCAGTGGTTCTACCTA
ATATTCGTTCTCTACATACTTGATTTATTGATGTTCACATTTGCTTTTGCAGGGCTTTAA
CTTTTATTATCTTTGCTTGCTAATAAAGTTCCTTGTCTATACTAAATGTGGGCATTTTTC
GAAAAAGTCAGATACATCAAAAATTTGAAAGGATGA


>Contig21290.0.g83(protein)
MLLFVISSIRCQTAIVDAPVNKRALFVKSSTDYQFAYKIDSPLDFIQNDYGFYTYWFRIV
GSELKDGYSMFQWINYDDYVNIWWVQAKRLMILRQDSQTYLCMTEYENVENARLQIKDGW
NHTVTWYFSVNMRIVTYDGAFSSNHPFYIYFMRNILFKDLSSTIKMGEMQFFYIKPEELP
KIRDILERYVGYRSIYQKYFPSVMDTYSLTWGKTSQYDNKGKYLDAKWKDWKDKDRFLDL
VSERVWWDEAESALNLCNATQRYNQGSNICVDCELPCLECSFFSESKCFSCVVGYTLVGY
KCIPSDCPRGQYFDSPSQTCKVCVDPCSSCSDATNCLYCDTGYLYIDDGSGVCVPNTQGC
SAGTYLDPSGLRICKKCSSGCKNCDSQIKCTQCQSQYLLYQDQCYMDQCPSGSMNDGLEI
SCLNCADSNCIACTTKECLQCKSGTFLSNKKCETSCPDGFYADSTSRSCMKCQSDCLKCS
GNNYTCSSCSAQTYLFGTSCVKECPKKLYFQDEAARECKLCDVKCEMCSNNKDDCGQCSQ
GNYLYQRKCDSICPVSFYLQEETRMCYPCHSLCQDCYGSLSTQCTKCATGFFLKETTCLD
ACPQPYFTDSVLQICDLCKYFCDECTSGQNCQVCLPGYQPIPNNCSGEYYLRGKSEKYLS
LPYNIDQLGPGEDPKQMTVEIWFKPENIYSINLEVILSLGPYKLRKRQNEASIHLSYQGQ
LVYCDTATSNKPLYSQLWYHFAWSMDENFLSLKCYLNGESIGVGTSPTQIITQNILRPSE
IIIGGTANPKVPETSFRGYFKELRIWKILRSAFQINYLKNVDVASWETFMYAYWKFDEKN
DGTIKYFKDSSYKGLQNFDPKTVDATYTVQKIVEMTEIDLKVCKEGFYPVYVDEGSYYTC
SKCNTACKNCKGPNSNDCVECTEPYKLIQAEFICKIIESCPEGQFKDLITGLCDTCDPGC
KTCIESGSFCQQCRANYFREFQGTSCVDTCPFGMYGDYQKQNCYFNPLISYITPLNGTVY
SYGTFIDLESQFSVLNNEPNDTYIYGWIIMDMRNQIDVSQDIVKTFYQKDQTKVHLDQNI
IRANRDYNITFYVQGDQQRYNRLYSTSTNQIYIGSPPKNGRCRVSPIIGIASITPFIISQ
QNWLDEEPIERYEFSYSIDGGDIYIPMSDELLTNPNFTYTFDSTYNQYTEVKIKCKATNA
RGFSNQVLNTISLEKRSSADSSKDLEDLQLTASLSEIQVLQKLQQVNLIAQNLGQLKVND
PLQFDPKVEVFQCTASTCNNRGNCTYLYYTKKYYCSCKAPFGGQNCSFDDGSQIDLIKKT
VSDIASIYNGMQDKQFEFEFLKLSTTYKEVMSESTYQIILSIITFKVQQWKDKPQTQDDL
SSFMIILSNMLEFIEYELIKNNVTNQWNYDSQNAIDIQEHIQSTLSLFDRIRDNSLKQLS
MVTTSQQFITRMVTYKQMLLSQESLMTLSASNFTKKNLRTFIKLSPSNFLGASFDLEQQF
AIEVIEYAVNPYQLQNVQHISNNVFSVKIYNSSTFDEVKISNMQNGFEIYFPNIDSQNLT
DFAKEYNSLSPYKAAQNLKRTKMLNSSSLACNYWNGNKWENSGCFFNGIDKTHIKCLCNH
LTSFAPQFLTPPAYTTKDESLPNKYENSENIEKGTITKKDLLVPFNKYFDNLEELLQHKT
PKPIDLIFKPGTYVVLMFWFMYISSLVYYSGRDRRRRGKMTKKQIREDLAEIKDKRIQQV
QEVMQDLLLRDAMNAKKRPKQKSSQNLNMHTSFGKINDDSTILDATSKTLIHDQSFSSPD
NRRIAAQNHRRISAIFNLGSIGPQNEASDTDLRLNLSQINTDSQQQSFTQVRQLSDLSKD
ELKELKRRAKRKVFGRVGTFSERANRFYKRTNKRHNPFQNNKMEFFNEALKATLWMGLLA
KTSKIAPRHARLALLYLYISVHLLITSTAFVLGYIDTFAEMIGDSLFSTLGAAILTLMAA
WVVCIPVALIFRMPMSLRRQIEGVRTKKINVVFREIDAQMSCRYAIGYFICYLFYLMMTI
VVTFFNFFYPSDYCIQWFYLIFVLYILDLLMFTFAFAGLQLLLSLLANKVPCLYQMWAFF
EKVRYIKNLKG