Identifiers and Description

Gene Model Identifier

Contig9964.0.g59

Standard Name

LSF1n

Aliases

Contig9964_0_g59

Description

Domain of unknown function (DUF4215)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam13948 ) Domain of unknown function (DUF4215)
  • ( pfam03302 ) Giardia variant-specific surface protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003134102.9993110246221282e-28hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9964.0.g59(coding)
ATGGTTGTTTAAATTATGTAAGATAACTTCGAGAGAAACCTTTAGACAAGTGTATGTGAT
TCCTCAATCAAATATTTCCCTGTAATTATTGGAGGCAGTGAAGCTGAATGTGTTAGAGCT
GTAAATTTAGGAAGAGTCATGGATGCGGACACTGATGGAAGAATAGCAGTAGCTGGATAT
CTTAGCGCTGCAGCAGGGGCTTAGTGTATTGACTATACTAGTGGCAGAACGGTTTTGCTT
GGATTTGTTTCCTTACTTAATGCTTAGGGAAATATTGTTTGGCTGAATCAAGCATCAGTG
GGATCAGAAGCTAAAGTTCCAGTTCTTGTAGCACTATCAGGCACAACCTTCTATGCTATG
TCAACTTCATTAAATGCCAATTCATACTTGAGATACATAAAGATTGATGCTGCAACAGGG
AATGTTTTAGCAGAAATAGAAGGAGATTCTATGTTTACATCTGCTACCCTCTATCATAAT
TTCAGAGTGGATAGGTCAAATAAAGACCTGTATCATAAATTTGTGATTCAATCTACAACC
CTCAGCTTTAGTGAATAGAGATCAATCATAATTAAATTAAACTCAAATCTGGTAGTATAA
TGGATAAAAACTCTTTACTGTGCATCTGTTAATCAAGTTTACACTTCTCTTGAGATTAAT
GTGGATAGTCCTGATATTTGGTAGCTCAGCAGAATTTTTACAACTGCAAGCTCAACTTCA
ACTTACACTTTGACAAAAAATTACTTATTAAATTCTGTACTCTTAGATTTGCAACTTTAT
GTAGCATAGACAACAGGAAACTTTATAATATTTGGCAGACTCCTTACAAGTACTAGTATC
AATCTTGTTTCAGCAGCCAAAGCTGGATCAAACTTTATTATTGGAATTACTTCAACTGCT
TATTTGACTACAAAGACTAGGATTGTCTTAATTGGAATTAAAGATGATGCGTATTCTACA
AGTGCCTCTTGTTTGAATTTCACAACTCCTACTTACGCTACTTTAACTGATTTAGGAACA
AGTGGTTCAACAACTTCAGCTACAGCTCTTTATTCAGCAGACAATGAAGCTTTTACATTT
AATACTGTTGATTCAGCTGACTATACTTTACAATCAGGATCAGTCAAATATCCAGACATT
GCGGTGATGAGAGATACATCTGTCTCTCAGCATTGTGACTTGCCTCTTATTGTAACTCCA
AGTTCCTTATTTATGGACACTTCACCCACCACATTTACTATAACTGAAATCAAAGATTGT
TCAGGAACTATTTATAAATTCACTGCAGCTAGTTGGCCTGATGGTGCAGGAACATCTGAA
ATCTCAATTAACACTGCTGCGTAGACTCTAACAATAACAATTACCTCTTAAACAATTAGA
GAAGCTTTAGGCAACTTTTATGCAATTAGATTGACAGTTGTAAATGATAACGTCAGTAGA
TTTGCTTATGTCAATGTAGAAAATAACATGGCTTTAAAAAGTTCAGCTAGAGACCCTAGT
ACTCCAAACCATAATGTTTCAGCTTGTACCATGCCAATTTATCCACTTCTTTATGGAGGA
ATGACAGTTGCATAAGACGTCAATATTGTACATTTTAATGTAGATTAGTATGGGAATATG
CTTTTAGCTGGGTCCGCTTAAAAGTAGCCATTTAATTTTCATGGTGAGACTTATGTGAAA
GGATATATCTCTTACATGGATTAAAGAGCAACTCCATATTGGACACACACAGTTATCGGG
TTGACTAATTATAATGCAAATGGTGAATGTACGTTTGCAACTCAATCTGGAGCATTTATT
TATGGATTATGCAGATAGACAAATGAATGGTTTTTAAATACTATTTTGAAATAACCAGCT
ATTCTTAAATTGTAAATTAGAACTGGAAGTCCCGTTTGGTATAGGATGTTGCCACAAGAC
AATACTAATCCAACTCTATAAACTCCAATTTTCATGGAGATTTTAAGCTCAAACAAAATC
TTGGTTCTTTACAAATATTAATGGACTACTCCTGCTTATTAGAATTTTGTAGCATTAAAA
TTCGATTAAACTACTTTCACATCAGATTATTTCAATTTTTATCCAGTTGACACAGGATTT
ACATATCCTATGCATTTCTTAGTTGATACTTCTGGAACTTACTTCTTTTAATTCAGACAT
TAAGGCACTAGTAAAGAGTTAATCTAATAGATAAGGATTACTGATGGTGTAGTAGAACGA
TAAGCATTAATTAACACAATTAACAGTGAAGATTAGAAAATGTAGCAAACATTCTATGGG
ACTGATAAAATTATTTTACCAATCATATAAACTGGAACTTAAGATACTTTCTAATTTTTT
GTGTTAAATAAGGCAGATCTGTCAAAAGATGCAGCTTTTTAACTAGTATTTCCATCAACA
GCAAATTTGGCTTCTGCAACTATTACTACAGATTCTTCTCAAAATATTTATATAACACTA
GGGCAAAATCAACTTTATTTTGCAAAGCTTGATTCGTCTTATACATTTACTGAGGGTAGA
ATGTGGAAAGGTGATTTTACTGAAGCTTATTATGCAGTAAATTCTAGAGTCCATGGTTCA
AACCAATTCCATGCATTCTATGGAAGATATTCGACTTCTACCTCATTTTAGACTCTAATC
TTTAAATTTGGTAATTGGTCGCAAACATGTTTCGACGTTCCTATATTACTTCCAACAGAG
ACTAATTACTATCCTACTTATTCCACAGTTAGTACTAATCCTACCATTACCACAGTATCT
AATGTTGAACTTGCAGCACCATTACCTACTGATAACTTTCCATTACTTGCTTTAATATAG
TCTATAAAGTAATCTAGTTTATCATATTCCCCTACAAAACAATATGTATGGGGTCTACAA
TCTATAACTGGAAAATACAGAAGATACCCTTACAGCGGTTAAATTTGTAGTCCTATAGAA
TTAGTAGCCGCTTTGAAAGACTCAAACACGTATGAGTTTACTCAAGCAACTGGTACAAAG
TCTATCACATTTACCACTGATTTTAAAAATTGCTAAGATAGGCCTACAACAGCACTCATA
TTGAATCCTTTTACAGATACACAATCAATGAAACAGCCCGGTATGTATACAGCTTCAAAT
AATGTACTAAATGTATTGACTAATGCGTTTGCATAACCAATAAGCCATAACATTAAGCTC
AGATATTAGGATACAACTTACACATCTTACTATTGGGATAATTACGTTCATATAAGGGTA
GTAAATTCAGTTAATGTGAGTTAACCAATTTAATGGGGGAGTGAAAGATGCGCTTAAAAC
CCATGGCCCATAGCTCTTGGTAAACAAGCATTAGATTTGACTAATACTTATCTCAATAGT
TTCATTGGCAATGATGATGATAAAAATATTGTAATAAATGGTTAAGCTAGATACAATAAT
TTATTCACATTAAATGAAGGAGATTATCATGATGGTTTCCTTGCCAGAATACAGTAAAAT
GGTGGAGTAGTGTGGTGGTCTTAAATGACATTTTTATTTTTACAAGATGAATTTGGAGGC
TCTTCTTTAATGCTTATGAATGAGCATGTTTATGCTTTTATAGCAACTTTTCCTGGAAAC
ACAGCTACTAGATATCACATGGTGGTCAAAGTCACTTACAGTGAAGGAAAATTAATATAC
TCAAAATAGCTTGTGACTAGAAGTTTAATAGATACCTAAGCTAATCTATTCTATAGAGCA
GGTGACATGCAGGTTAATCCAAGAAATACTTCATAATTCTTTACTTAATACAGTGTTATG
GCTGATAGTTTCACCACATTTGTACCTGGAGGTATAATGTTTTACGAAGATGGAAGAATA
GTTAGCACCTTCGATTACTAACTTAAAGTATTGTCAGGTTGTAAATCTTCTCTTGGTTAA
GTACTATATGATCCCATTGAAGATTACATGTATGTTGGATATATGACATGTATGATAAGC
ACTACATATTAAAATATGATTATACTGAAAATGTTCCCATAAAATGGTACTATTGTTTGG
TCTAAGTAATATGAAAATCTTGATATGGGTTAAACTCCAAGCAATTAAGATCGAGGAGAT
CCAGTTTTGAAATACAATAAAAAATCTCTTCATTTTTATGCAGTTTTCTCTTACGGAAAC
ATTCAAATTGTAAAGTTTGATTCTAGTGGTACTACAAAAGGAAGAGTTTAAATAAGGATA
TCATCACATACAACCTTATAGACAGATATAGCTATGAATCATGATAACGGAAACCTAATT
ATTGTATCTGTCACAGAATCATATTCATACATCGAATACATAACTCTTGATGAAAATTTT
GTTGCTGTCACATAAACTTTTCAAGGTCATCCTTATTGGTTTTCTAACAATGTACGACTT
ATATAGCAATTTAGTGATGGCTACTTTATGATTGCTTAACATTCTTAATATTTCGGAACT
CCTTACGCAGGAGAACAAATAACAATTTCAAAAAAATCTCTAAACTTATACGAATTTTAC
AAGTATGAATGCCATAACTAATTATATGTGTATTCTCCATATTCTGTGATAAATACTTAC
ACTTCAAACAGTGGAACTTTATCTGCAGCTAATTTTTATATGAATATAGTTCCCTTAGAG
TTAGTTGATGTGCCTTGGCTTTGGTTCAGATAAATGAGTTAGTACTATTCTTAAGCTTAT
CCATTTAGTGAATATTCTACTAGTTATTACTTTTCAGGAACTCCAAAGACTTGCGCTTCA
GGTGGAGGTCTTCAACCTCCCCCGTACATTTATGACACAATAGAATTAACTTAAGGAGAG
ACAGTAACATACACTTTCAACTCTACAAATAAGCAAAACTGTTAAGGCTATTCAACTGTT
ATATATACTGTTTATGACGAAACTGATAGTTCAACTAGATCTGCTACAAATAATTTCATA
ACAATAACTGGAACAAGTAGTATACAAATAGATGCTACCGGATCGGTTCCTTACCCAGGA
ATAAGATGGATTCACGTCAGAAGTTATACTGCTCAAAACTCTCTTTGGACAGATCCAAGT
TTTATCAAGGTAGTCGTTTGGCCTGCTACAAAGCCTGCTGCAAGTTCATCTTCTGCACCC
ACACCAGTATGTGAAGGACACGAAGCAAGATATCCAAGAATATATGGACAAAATGACGGC
CATAATATCATATATTGGGCTGATATAGATCAAACTAATGGTAATGTTTTGATATGTGGA
GAAACTACAAGTAGCTATAGAGTTTTAAATTACAGATACAATAAAAATTCCTTCATTAGT
TTGATTGATCAAAACATGCAAGTTTAATGGGCTTGGTCGACAGGTTTTACTGATTCTTCA
TACGCTGCTTGGATGGGTTCATGTGAGTTTGCTACTAATGAATTCATCTTTGCATTAAAT
CTTATTAATTACGATAATGTACTAGCAATATCTAAGCATGAGTATGCAACAGGCTAAACG
ATGTACATAAAAAGGATATCAGGCAAGTTCCATTAAAGTCAGTTTGATTATCAACTAAGA
GTAGATACAAGCGACAATAGTGTATATGTTGCAGGGATGAGACTTGATTGGAATTAACAG
ATGCATTATGTAACTAAAATTGATGTCACTACAGAAAATGATGCTGTTTAATAGTACTAT
ATTGAAGGTAGAGTCAATGGATGGGGAACATCAGTTTATTACCTTCCCGTTAGAAAAATT
GCATTTTCTTCTGAATCAGATGGGTATTTCATTTCTTCTGGGTATATTTACTAATACTAC
GAAGCCTCATATAGATACCTTTAACTTGGATTTTTCAATAAACTCACTGGGCAATTTTTA
GGATCAAAGCATTTCAAATCGAATACTCTTACAGATGCTCCTTAAGTGCATGATGTGTTG
ATAAGCGATCCTTACATATATGTAGGATTTAGTTAATATGGGTCAGGGTATTGCGTAAAA
TAAGTATCTTAAATGAATAATGCAACAAGAGCAATCATAAAAGGTATTGAGTATAATGTT
CAAGGTTGTGGAAGTTATTTCTTTAACTCATTTGATGCAGATGATACATATCTCTATGAA
GCATTTCATTGCAACACAAATAAACTGATAATAACTTAGTTTGACAAAGTCACACTTGCC
ATAATTCAAATGAAATAGCACTATCATTCATCAGGCAGTTTCTATGAAAGAGTATTTTTT
AGATTGTATTTAGGAAGTTTGTTTATTTTTGGAAACACTTATACAGGATTCATGCTTGAT
TCTTCGTACTATGTTGGCTTTATCAATAAAATAGAAAGTACATTCGAAACTCCAAATTCA
TGTATGGAATTTTACCCATATCCTTATCCTCGTCCAGTAACCACAAATACTCTAATGTAT
GATTAGACTGGTGCTGTCTCTTTCACTACAGTCTTAGGTTCAGCAAAGACATTGTAATTA
GGAAAACACTACTCAGAACTACTAAATATTACAAGATTCAATTTGAAAGATCCAATATTA
GAATCCTGTTATTTCTCCGCTCCACAATTCTAAACTAAACTTGAAGATTAGATATTTACG
TTACCAATTGATCCAACTGACTACAAATTTGATTGGCCAACAGATTGCTTTGCGAGTGAA
CTTAAATTTACCTGGTCAGTTGATAAATATACAACTGCACCATCATTCTTGACAATGAGT
AATGATACATCATCCTCTACATTAACTATGAGTCCTGCTAATACAGATGTTGGAACTTAC
ATAGTAAGAGTAACCTTTACGAAAGTTATAGAGCCAGATGTATCCTTTTCAGATACTTTT
GTAGTAGAGATATACCCAAGTGTTGCTTATGGGTCAACAAATTTAAATGAGAATTGTCCT
ACAAGAACTATTCCAATTAACTGGTATAAAGAAGGTAACTAACAAACATATGGTATGGAT
TTAAGTTAAGGAGGTGACAATATTCTAATATGTGGAGCTGCAAAAGATTATTGGGTATTA
ACAACATCCTATTATCAAGGATTTTTCTAATCTTACACTAAAGGTCCTGCTTTAAATTTT
CATTTAACTCTAGACATTGGAAGTGCCTTAAGTCTTGTTAGAGAGTGTTAATTTGATTTA
CTGGGAAATATAATGACAATGACTTCAGCTGCAACTTCCTCTGTCATTGATAGGATTATC
TTTATGTAACACACTGGGAATGGAAAGTATATTTAAGGTAAGCAAATGTACTACAAAGAT
AAAATGATCATTGGGCTTAATATGTACTACAATCTCATAAATGGAGACTACTATGTAACT
GGCTAGCATTAGAACGATTTAATGACATTTGATAGCTAAATATCTAATTTTATTATGAGG
ATGACATCAGATTTTGTTCTAATATTCTTCAGAAACTATGATGCAGGTTATAAATTCTAA
GGATATGATTTAGCTGTAGATGCCAGTGCAGGTTATGGTTACTAATTATTCTAGTTTTAT
CACTAGAATGGGTGTGATTACTGGGGGATTTAAGGCTTTTCAGTAATTGATGGATCAAAT
CAATGGCATAAAACACTAAGAGATACTTCAGCAAATGATGCATATTAAGATAGTGCAGTT
GATGATTCTTAGTAAGGAGGAATAGCATACTCAGGGGCTCATCTTTATTCATGTTTTTCA
TACTACAGACCAAGTTTTTCATCAGGGGAGTTATATTTTGGAAAGCATAGTTTAACTGAC
GGCTCATTAATTTAAGGTGTAGATTTAGCTTATGGCTATGTTAATACAGTCACATGCGAA
TTTTCGAGTGCATCTGAGTAAGTCATTTTCATGGCTGGACTTAACGGCATTTCAGAAGCA
ATTGTATTTAATGTTGCTGTGACACCATTTACTTGGAAAACCAAAACAATTACTGCTACA
ATACCTTCTACTTTTTTTTCAAGAATTAAAATTTTTGAAAGAAGTAATAGCATGTGGATT
TATTTAAGAGCTCACTATGGTGCAATAGCTGATGGAAGACACTAAACTGTATTTGCTTAA
GTTAAAGATTTGACAAACTTTGTTTGGGATTAAACCTGTACCAATTTTTAAAACATGAAT
AGTTTAGATTTCAATATTCCAAATGGTATTGGAGTTGGAGTTTTCAATATTGCTAGCTCT
TGGATAAATATGGCTACCTTTTATACAAGAGAAGTTGAATTAGATTAAGTTTATAGATTG
ATGTCAAACATAAAAAACATAAGATTCATTCCTATAACAAACTTAACAGCTGATTTCAGA
TTATCATACTCTGGTTGTTTGCACATTTCTAAACCTACTAAGCCTGTTCAACAAGATAGA
ATAGGGGATCCAATAAATGCAACCGCAGGAGGATTAAGTGTCGGAAGTCTCACATACAAA
GCTATTCTAAGTACTTGGTTGCATTGCACAAATGAACCTTTAACATTAGATCTTAAAATA
TCGCCTTCAACAGCTTTGCCTACATGGATGGTTTTTAATTCTACTGGTTCAAGCATTGAC
ATCACTCCAAATTCAAATTCTCTAGTTAATGTTTATACACTCAGATTTAAAGCATCAGTC
ACCAAAGACACAACATTTTTCGATTTTATTGACTTCAAGATCGAAATCATTAAAAATAAA
CCTCCTATACCTTTTATGGATTTTTTGAGTCCTGTGGTAACTGTTGCTCACCACGACACT
AGTTGGGTAGTTTCCTTTAATAGTGACTTTGAATATGATACAGCTATATTTTCTGCTCAA
GTTTTAAATAACTTAAATTCTACAATAAATTCCACCATATCATGGTTTAAAGTAACCTAA
TCTGATGATTAAGGAATAGAATTTTCAGTAATTAATCCACCATAACCGATTACAGGGCAA
ACCCAAACACAATATTACATTAAAGTGTCAGTATGGGATTAGTATAATGTAGCTACTCCA
AATGAATACTTTATAAACTACATTGTGAAGAGAAATTATGTTCCTTACAATCATTAGCCC
TTAAATTTCACTCTTGACACAATCGTAATAACAAAAGCTTTTACTCATACTTTTTGGTAT
CAAAATTTCACAGATGACGAAGGAGATAACCTATTAATATCATGCGCAGCAACTACAACT
GGGAAAGACACTACTTGGATTAAATTTGAGTACAACTTAACTGTAGATGGAAATATAACA
TTTTATGGGGATACTCCAAGAAATAATGAATATAATGGAACTTATACTATTGCATGTACT
GTCAAGGATCAATGGGATGGAACACCAAATGTTTATAATTTCTCATTGATAGTGCTACCT
AAAGATTAAATTATTATTACTGGTACATACACAAGGCTTTATGTTAGACTTCCGGATAAT
ATAAAATCTAGTTATACAAGTTATGACAACCTAGGAGAGCTCAATTACTATTCTCTGTAT
GTCAATAATACATTATATGATCCAGCTGTGTTCTGGACCTGGTTTAAATGGTGGGATACT
AACCAATCCTTAACTGTTTATCCTTACAGCAACTCATAAGGAGGAAACCATTCATTGTCT
ATAAAGTTTGATGATTTGATCTCTGTTCCAATGTACATTAATATTACTCTCGAAGTAAAG
TAAAATTGGCCTTTAAGAGTAATCAAGCCACTCGACAATGTTAATGCAATTACAAAAAAT
GCCTTTCAATACGATTACAACAAAGACGAAATATTCTTCAATCCTGAAGGAGAACCATTC
ATAATGTATTTTAGAGAAGCAGACACTGGAAATAAGTTGCCATATTTTGTAACAAAGAAC
TTTTCAAACGGAACAATTGGTGGATTTACAACTGATTAAGATATTGGAATTTATAACTTG
GAATGTGTGGGTATAGATGATGCTTTTTGGGAAACTGTAATCCCTTTTACTCTAAGAGTT
AAACCTTGTTACTATAAATGCCAAACGTGTTGGGACTCTGACTACAACTAATGCTTCACA
TGCAAACCTAACTTTTTCTTTAATAAGAATGAATGTTTAGATTAATGCATGGATGGAACG
TATGCGGACACTATAGAGTGGGCTTGCAAATAATGCCCATATTAATGTCGTATATGTACA
GGGAATGATCCTTTGAGTTAATGCCAAAAATGCGCAACAGGCTATTTTAAGATGGGAGAT
GGATGTTACGATAAATGTCCGGATGGTTACTGGGGTGATTAGCAAGACTACACTTGTAAA
TAGTGTAATTCAGCTTGTACATTATGCTATGGGCCTTCCTCTTTACAATGTACCAAGTGT
GCAAACCTTGAAGGAGTAAATGAAATAGGAAAATTAAGAAAAATTGGATATTTGCTAAGT
GGAACAGAATGCAAAATACCAAAGTGCCCAGAAGGTCAATTCTTTAAATGGGAATACAAT
TTAGTCAAAGATCTTTACTTTGGATAATGCTAGACTTGTCATAGTAGGTGTAGGAAATGT
ACTGGAGCATCAGAATTAGAGTGTGTTCAATGCTATCAAGGGTCGATTTTAAATTCTACA
TTGCATACATGTAAATATTGCCATGAAATTACTGGACTCTTTACGAATGAAGAATTAGAA
TGCGAGGATATTTGTGGTGATGGAATTTTAATTACAAAGTAATGTGATGATGGTAATGCA
CTTTCAGGGGATGGTTGCAATGATAAGTGTGTAGTTGAGTATGGTTTTGCTTGTCCAATT
CCTGGAATACCTTGCAAAGAAACAATTCCTCCTACTTTTAGAGTTTCCTCAATAAATGCT
AAAAATTTGATATATGTGGAATTTTCAGAGCCAATTTAGATATTTGAAGAGACTGCATTA
TCACCAGATAATATCTAGATAGAGATAACAGGTAAAGCAACAAAATACAAGTTTTCTTGG
AGAATGATTAATGATGTTAAGAATCCTCTTTTACCAGGTAGAATTATAAACAAATTTGCA
TTTGTTTCCTCAGAGTTCTAGTAGTCATTAGATGGATCAGAAAAATATAAGATTACTTTC
CAGAATTATTCGGCGATTTAGGACTTGGCAGGAAACCCTGTAGCCGCAGAATCTTATGCT
GAAATAAATGTAAATAGTTTCGTATTTCTTTCTGCATCAGAATAATCAACTATCTCCAGC
GGAGGTTCTTCTTTAAAATACACATTCATGTCAGTCTTTAGTTTTAACTTGGTCCTAAAA
GTAGTACTTAATTCATCCATGCAATACTTGTGGGGTCTAGTACATGCTCTTCAAGTTTTT
AATTTCTTACTTTACATGAATATTGATTTCCCCAATAACGTGTAAACCTTTTCAGGATAT
CTTAAAGTTGCTTCAGGAGACATAGAGGAAATGTAATAGTACATTCCAAATATAGCAGAT
TATATAGTTAATATTAAGAACGTAGAAAGTTCCATGGATAATGAAAAACTATAGCAAAAG
TTCATTGATGATGATGTACCACCTTATTTCATAGTGGCTTTCGGGTAAAAATTGACATTG
TGGTGTATTGCCTTCTTAATTATTCTCCCATTCTCATTAGTATTGAACAAGCTTTGTAAG
AAAGTTAAATTATGGGAAGAAATTATTGGAGCATTTTTCTTTAACTTGCCATTGAGAACT
TTTATTGAAATGTATATTGAGTTGATCCTGTAGGTTGTTGTAAATACTCAATTCGTTAAG
TTCAAGAATCTAGACTAAATGATAACAACATTAATTGCTTTTATATTCGGAGCTATTTCT
TTGCTTTTACCCTTTATGGCAATGACCTTAATTTATCACAACAGAAGGATTATAAAAAGT
AAGAAATGGAAAATGAAGTTTGGAATGCTTACTGATGAATGCAGATCGAAATCTATACTT
CAACTTTACTATTACCCGCTGTTTATGTATCAAAGACTATTTATTGCAGGGATTATTGTT
TACGTGTATGACATGCCGTTACTATAGTGTTTAATGGTAATGGCATGCAATTTAGCAATG
ATAGTCTTTTTAGTTATTATTCGGCCATTTAAAGAGGAAAGTTAGTAAACAACTACAGTA
CTTGACGAAATTGTAATTATGGTGTGCGTAGGCCTATTCATTAAACTCTACTAAGGTGGA
CCAAATATGGATCCTAGTTCTAAAAAGGACTTAGGTTGGGGAATAATAGGTTTGATTATG
TTTAGTGTCTGCAAAAACTTTGGGGTAGTTATTTACTTTGGAATACAAAAAACATAAGAA
AAATTAAGAAAAATGTTCTCAGCTGATGACTAACTAAAAGATTCTCCCCACACAAGCGAT
GAAGATGATATGCTTGGAGACAATGATATGAGAAATGATTTAGACACCGAAGAAATACTT
TAAGAGATATAGGAAGAAAGGCAAAAAAATTAATTCTCTGTAGGCAAATAAAATAAAACG
AATATCTTCTTTAACAACTCTTAATCAGACCTATCTTTTAACAACTAAACAGGTGCAAAT
AAAATTTAACCTAGATATAACCCAATGTAAACGAATGTTATAAAACTTCAAAGTATGCAA
AAATTTGAAAACAATAATCTTAAACCGATTAAATAGCAAGATTAGCTTAATGAATTTTCA
AGATAAAATACCTGA


>Contig9964.0.g59(protein)
MVVQIMQDNFERNLQTSVCDSSIKYFPVIIGGSEAECVRAVNLGRVMDADTDGRIAVAGY
LSAAAGAQCIDYTSGRTVLLGFVSLLNAQGNIVWLNQASVGSEAKVPVLVALSGTTFYAM
STSLNANSYLRYIKIDAATGNVLAEIEGDSMFTSATLYHNFRVDRSNKDLYHKFVIQSTT
LSFSEQRSIIIKLNSNLVVQWIKTLYCASVNQVYTSLEINVDSPDIWQLSRIFTTASSTS
TYTLTKNYLLNSVLLDLQLYVAQTTGNFIIFGRLLTSTSINLVSAAKAGSNFIIGITSTA
YLTTKTRIVLIGIKDDAYSTSASCLNFTTPTYATLTDLGTSGSTTSATALYSADNEAFTF
NTVDSADYTLQSGSVKYPDIAVMRDTSVSQHCDLPLIVTPSSLFMDTSPTTFTITEIKDC
SGTIYKFTAASWPDGAGTSEISINTAAQTLTITITSQTIREALGNFYAIRLTVVNDNVSR
FAYVNVENNMALKSSARDPSTPNHNVSACTMPIYPLLYGGMTVAQDVNIVHFNVDQYGNM
LLAGSAQKQPFNFHGETYVKGYISYMDQRATPYWTHTVIGLTNYNANGECTFATQSGAFI
YGLCRQTNEWFLNTILKQPAILKLQIRTGSPVWYRMLPQDNTNPTLQTPIFMEILSSNKI
LVLYKYQWTTPAYQNFVALKFDQTTFTSDYFNFYPVDTGFTYPMHFLVDTSGTYFFQFRH
QGTSKELIQQIRITDGVVERQALINTINSEDQKMQQTFYGTDKIILPIIQTGTQDTFQFF
VLNKADLSKDAAFQLVFPSTANLASATITTDSSQNIYITLGQNQLYFAKLDSSYTFTEGR
MWKGDFTEAYYAVNSRVHGSNQFHAFYGRYSTSTSFQTLIFKFGNWSQTCFDVPILLPTE
TNYYPTYSTVSTNPTITTVSNVELAAPLPTDNFPLLALIQSIKQSSLSYSPTKQYVWGLQ
SITGKYRRYPYSGQICSPIELVAALKDSNTYEFTQATGTKSITFTTDFKNCQDRPTTALI
LNPFTDTQSMKQPGMYTASNNVLNVLTNAFAQPISHNIKLRYQDTTYTSYYWDNYVHIRV
VNSVNVSQPIQWGSERCAQNPWPIALGKQALDLTNTYLNSFIGNDDDKNIVINGQARYNN
LFTLNEGDYHDGFLARIQQNGGVVWWSQMTFLFLQDEFGGSSLMLMNEHVYAFIATFPGN
TATRYHMVVKVTYSEGKLIYSKQLVTRSLIDTQANLFYRAGDMQVNPRNTSQFFTQYSVM
ADSFTTFVPGGIMFYEDGRIVSTFDYQLKVLSGCKSSLGQVLYDPIEDYMYVGYMTCMIS
TTYQNMIILKMFPQNGTIVWSKQYENLDMGQTPSNQDRGDPVLKYNKKSLHFYAVFSYGN
IQIVKFDSSGTTKGRVQIRISSHTTLQTDIAMNHDNGNLIIVSVTESYSYIEYITLDENF
VAVTQTFQGHPYWFSNNVRLIQQFSDGYFMIAQHSQYFGTPYAGEQITISKKSLNLYEFY
KYECHNQLYVYSPYSVINTYTSNSGTLSAANFYMNIVPLELVDVPWLWFRQMSQYYSQAY
PFSEYSTSYYFSGTPKTCASGGGLQPPPYIYDTIELTQGETVTYTFNSTNKQNCQGYSTV
IYTVYDETDSSTRSATNNFITITGTSSIQIDATGSVPYPGIRWIHVRSYTAQNSLWTDPS
FIKVVVWPATKPAASSSSAPTPVCEGHEARYPRIYGQNDGHNIIYWADIDQTNGNVLICG
ETTSSYRVLNYRYNKNSFISLIDQNMQVQWAWSTGFTDSSYAAWMGSCEFATNEFIFALN
LINYDNVLAISKHEYATGQTMYIKRISGKFHQSQFDYQLRVDTSDNSVYVAGMRLDWNQQ
MHYVTKIDVTTENDAVQQYYIEGRVNGWGTSVYYLPVRKIAFSSESDGYFISSGYIYQYY
EASYRYLQLGFFNKLTGQFLGSKHFKSNTLTDAPQVHDVLISDPYIYVGFSQYGSGYCVK
QVSQMNNATRAIIKGIEYNVQGCGSYFFNSFDADDTYLYEAFHCNTNKLIITQFDKVTLA
IIQMKQHYHSSGSFYERVFFRLYLGSLFIFGNTYTGFMLDSSYYVGFINKIESTFETPNS
CMEFYPYPYPRPVTTNTLMYDQTGAVSFTTVLGSAKTLQLGKHYSELLNITRFNLKDPIL
ESCYFSAPQFQTKLEDQIFTLPIDPTDYKFDWPTDCFASELKFTWSVDKYTTAPSFLTMS
NDTSSSTLTMSPANTDVGTYIVRVTFTKVIEPDVSFSDTFVVEIYPSVAYGSTNLNENCP
TRTIPINWYKEGNQQTYGMDLSQGGDNILICGAAKDYWVLTTSYYQGFFQSYTKGPALNF
HLTLDIGSALSLVRECQFDLLGNIMTMTSAATSSVIDRIIFMQHTGNGKYIQGKQMYYKD
KMIIGLNMYYNLINGDYYVTGQHQNDLMTFDSQISNFIMRMTSDFVLIFFRNYDAGYKFQ
GYDLAVDASAGYGYQLFQFYHQNGCDYWGIQGFSVIDGSNQWHKTLRDTSANDAYQDSAV
DDSQQGGIAYSGAHLYSCFSYYRPSFSSGELYFGKHSLTDGSLIQGVDLAYGYVNTVTCE
FSSASEQVIFMAGLNGISEAIVFNVAVTPFTWKTKTITATIPSTFFSRIKIFERSNSMWI
YLRAHYGAIADGRHQTVFAQVKDLTNFVWDQTCTNFQNMNSLDFNIPNGIGVGVFNIASS
WINMATFYTREVELDQVYRLMSNIKNIRFIPITNLTADFRLSYSGCLHISKPTKPVQQDR
IGDPINATAGGLSVGSLTYKAILSTWLHCTNEPLTLDLKISPSTALPTWMVFNSTGSSID
ITPNSNSLVNVYTLRFKASVTKDTTFFDFIDFKIEIIKNKPPIPFMDFLSPVVTVAHHDT
SWVVSFNSDFEYDTAIFSAQVLNNLNSTINSTISWFKVTQSDDQGIEFSVINPPQPITGQ
TQTQYYIKVSVWDQYNVATPNEYFINYIVKRNYVPYNHQPLNFTLDTIVITKAFTHTFWY
QNFTDDEGDNLLISCAATTTGKDTTWIKFEYNLTVDGNITFYGDTPRNNEYNGTYTIACT
VKDQWDGTPNVYNFSLIVLPKDQIIITGTYTRLYVRLPDNIKSSYTSYDNLGELNYYSLY
VNNTLYDPAVFWTWFKWWDTNQSLTVYPYSNSQGGNHSLSIKFDDLISVPMYINITLEVK
QNWPLRVIKPLDNVNAITKNAFQYDYNKDEIFFNPEGEPFIMYFREADTGNKLPYFVTKN
FSNGTIGGFTTDQDIGIYNLECVGIDDAFWETVIPFTLRVKPCYYKCQTCWDSDYNQCFT
CKPNFFFNKNECLDQCMDGTYADTIEWACKQCPYQCRICTGNDPLSQCQKCATGYFKMGD
GCYDKCPDGYWGDQQDYTCKQCNSACTLCYGPSSLQCTKCANLEGVNEIGKLRKIGYLLS
GTECKIPKCPEGQFFKWEYNLVKDLYFGQCQTCHSRCRKCTGASELECVQCYQGSILNST
LHTCKYCHEITGLFTNEELECEDICGDGILITKQCDDGNALSGDGCNDKCVVEYGFACPI
PGIPCKETIPPTFRVSSINAKNLIYVEFSEPIQIFEETALSPDNIQIEITGKATKYKFSW
RMINDVKNPLLPGRIINKFAFVSSEFQQSLDGSEKYKITFQNYSAIQDLAGNPVAAESYA
EINVNSFVFLSASEQSTISSGGSSLKYTFMSVFSFNLVLKVVLNSSMQYLWGLVHALQVF
NFLLYMNIDFPNNVQTFSGYLKVASGDIEEMQQYIPNIADYIVNIKNVESSMDNEKLQQK
FIDDDVPPYFIVAFGQKLTLWCIAFLIILPFSLVLNKLCKKVKLWEEIIGAFFFNLPLRT
FIEMYIELILQVVVNTQFVKFKNLDQMITTLIAFIFGAISLLLPFMAMTLIYHNRRIIKS
KKWKMKFGMLTDECRSKSILQLYYYPLFMYQRLFIAGIIVYVYDMPLLQCLMVMACNLAM
IVFLVIIRPFKEESQQTTTVLDEIVIMVCVGLFIKLYQGGPNMDPSSKKDLGWGIIGLIM
FSVCKNFGVVIYFGIQKTQEKLRKMFSADDQLKDSPHTSDEDDMLGDNDMRNDLDTEEIL
QEIQEERQKNQFSVGKQNKTNIFFNNSQSDLSFNNQTGANKIQPRYNPMQTNVIKLQSMQ
KFENNNLKPIKQQDQLNEFSRQNT