Identifiers and Description

Gene Model Identifier

Contig1229.0.g112

Standard Name

LSF1l

Aliases

Contig1229_0_g112

Description

Furin-like cysteine rich region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( pfam00757 ) Furin-like cysteine rich region
  • ( pfam11846 ) Domain of unknown function (DUF3366)
  • ( pfam03302 ) Giardia variant-specific surface protein

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000392602.0004062814618821e-57hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig1229.0.g112(coding)
ATGAAATTTATGATAGGTGCTTAATTGGACTTTGTGGGTGTATAAGCTGATCCATCAATC
GTGGGGGAGACCACAGCTAATTTATATGTTCAAACAACACTGAAAACTTAAGTGCCTTCG
GGTGGTTTTTTGAAAATCATATTGCCTTCAACTAATGAAGTGGCCATTAAATAAGGATCT
TTGACATGCTCAATAACAGGAGATGTAACGCAAACAGGCCTGACTTGCACTGCTTCAGGT
CTCTCAATTACAGTGACAACTAAAGCAACAATATCAGCATTTGCTACTATTCAAGTCAAC
GTCTAAAATGCATTCCAAACACCAAGTTCTTCTCAAGAAACTTCAAGCTTTACTTTTGCA
AGTTTAGCTACAGATGGAACTACAATATTGGATATATTGAACGCTGGAATTACTTTAATT
GTATCACCTGACACTTTTACATCAACTACGATAACTCAGATTGATTCAACAGTAGTAGGG
TCAACTACTTCTGTTTTAGTGAGCTTAGTAAACTAAAATACAATTTTGGCTGGTTCTAGA
TTAAGACTAATTTTTCCTAAGTGGAATCCTGCAGCTTCAAGTTCATAAATAGTGCCTATT
GTTGCAAATCCCACTTCTGTGACTTGTACTTAAAGAACTAATGTTAACTCGAATGTGAAA
TGTTCATTTGATACAGCAACGGACTCACTTAATATTATTGACGGATTTCCTTCAGGATTG
AATGCTGGAACTCAAATATAATTCGTAATATCAAACTTAAGAAACCCACTTTCTTTCGCT
CCTGTTTCGATTTAAGTGCAATCTTTGAATTCAGCAGGCACAGGAATAATCGAGAATGGC
TCAATTAAGTTTGCACCTTCTATTCCAGCTACTATAAGTGCCACAACTGCAAAGACCAGT
GCTGACCTAACTACAGTCTAAGAATATTCAAATTTTAGATTGGAATTTTAAAATCCAGTT
CCTTTAAATGCAGGCACCATAGTTACTGTGGTTTTCCCGTCATAATTTAGCTTTGAGTAG
AAGTTAGCTGCAGTTCAAGGCTTTGGTTTATTTGGGTCTATTAAAAATCTGGCTTACCAA
GCTGACTCATCTTCGTTATCAGTGAAATTAACATCAGCAGCTATAGATTCTTACAAGCAA
TCTGGTATAGCAGCTATTTTAACTTTCCAATAAGTTAAGAACCCATCTGTTGTCCGTGCA
TCTGATTCATTCTCAATCTACCTTACTGACATTAATGGGTATCAAATCGCTTAGGCAACT
ACAGGCATCGCTTATACGCCGACAAGTGGAAGTATTTCAGGTGTCAGCGTTGAAATGGCA
GAGAAAAGTATAAATTAAATGGGCAGTTTTGTTCTCAAATTCTAGCCACTGCATATTCTC
ACCACAAGTAGCATTTTATAGGTACAGCTACCCACTAATTTGGATGTGAGCTGTACAGGA
TTAAAAGTGTCTGGTGGTCTATCATCCAGCATCACGTGCACTGAGGGTGCAAATAATTTG
TTTACCTTTGAAAATCTGTTTTCTACATAATACACCTTCTCTTCAAGTAACTTCCTCACT
TTGACATTTGCAAATGTTAAGAACCCAGGATCAGCTCAACAAATTAAATCTCTCTCGATT
GCTACATTTGAGAAAATTGTAGTTGTAGGGGGTCCACAGAACTTCGCAGTTGATGCTTAT
AGTGATTCAAGCATTGTCTTATATACCACCACTGCTTCTTAGTTTAAGAGCCAAAGCATT
GAAGTTAGTACAAATGAAACATACACTGATGCTACTTTTACTATCACCTTAGTGCAAGAT
AACTAGATTCCTTAAAATGGTATATTGGTAATTGTGATACCCTCTGAAATTACAATAGTC
TCCTCAGCTAAATGCACAGGTATCACAAATCTTCAATCTTCACTGACTTGCTCTTAATCT
GGGAATAATTTGACTATTACTAACGGGTTTTCTTCTGGCTCTAAGCCTGAAAATTCTACT
CTTAAATTTTCCATATCAGGACTAAGAACACCCTTAACAACACAGACAAGTAGCACTTTC
CAAGTTTACAGCAAGGATTCTAACTCTCAATTCATAGACTAAGTCCAATCCCTTCTAACT
GTAACAATGTTAGTCGGTAAGAAAATCACCACAATGAGTGCATTAAGTGACAGCAACATA
GTAGCAGACTCAGCAACACTAAGCATCACTGTTAAACCCACAATGCCATTAAAGAATGGG
GATATTATGTATTTTACCATTCCCAGTTCAATTACTCTGCCACTCAAATCTGCATTAACT
TGCACAGGAGCTGATGCTCTTAAAGCTACTACTTTAAGTTGTACAACTAATGGATAGATC
TTAATTGTTACGGTCAATTTAAATACTAGTCCATCCACTCCTAATTCATCAGTACTTACT
GTAAGAGTAAAAACGATACTCAATCCAAAAAGTACAAAACCAACTGCAGAAATAAGTTTA
ATAGTTAGAGATTCAAAAGATTATGAAATTGGTTAATCAAGCACGGGTACCGGGGCAATT
ATAGTTGTGGGTACTCCTGCATCTATTACTACTGGCACACTTACGCCTCTAGACTACAGA
CAAAAAGCTTATACTGCAATGACAATAAAGTTTGCTACATTAAATCCGATTCCATCTGGG
GGTTACTTATAAGTTGAATTTGACTAGAGATATTTCTCTGTAACAAAAGACAGTTCTTTC
AAGTGCACCTCATCGCTGGTTAAGAATGTTGAAGTTACTTGTGAGTTCACCAGAGATAGT
GTATTTCTAGTAAAGGATATCTTCCCAAAAGACCTCTCATCTTCTCAGCAAATAGATTTC
ACCATAAACAATGTGAACATAAATTATGAAACAAAAACAACTGCAACTCCCAGTTGGAAG
GTGACTAGTATGACTTCAGATGGCTTTATGATTGATAAAATTGATAATGTTTTAACGTTA
AGCTTTCCATGTAATGTGCCATGTTTGAGTTGCCTCAGTAATAACCCAAACTATTGTCTA
AGTTGCAATACACTTACTGGTAGTACTATTCTCTATAACAACAAATGCTTGAACTAATGC
CCAGATGGGTTGTTTTACAATTAAGACAAATTTTAATGCGATACTTGTGTAACTACTTGT
AAAACTTGCAATCCCTACAACCCTAATGAATGCCTTTCTTGTAATATAAATTCTCCTCTC
TATCCTTACTAATTGGGAAACACATGTACAGACTAGTGCCCAGTTGGTTTCTTTTCCAAT
AATAAAACTGCAGCATGTGAACAGTGTCAGAGTCCATGTGCTACATGCTCAGGTTCCGCT
AATAGTTGCCTCAGTTGTGATGAAAGTAACGGGTTCAAGTTAAAATATAACGATAAGTGC
TATTAGACTTGTCCAACTGGTACATTTGCTGATGATAATAATCAATGTGTGAAATGTGAT
TCAAGTTGTTTGACATGCTAGACATCTGCCACTTTCTGTACTTCTTGTCCATCTAATAAA
CTTCTATCACTTTATGAAAATAATTGTGTTGATACCTGTCCATTTGGTTAAACTATCTTG
AATTCTGGCAAGAAATAATGTGATACTTGTGATCCTAAATGCTTAACTTGTGAGAAATCA
ACCACATTCTGCACATCATGTGCCTAAAGTCTTAACCTAATAGAAAAAACAGGTGTCTGT
ACTGGTGAGTGCTCATCAGATAAAAAAACTGTAGGTTTCAACGGAATATGTACCCCTTGT
GATACTAAATGTGCAACATGTGTAAACAATCCCACTTCCTGCTTGACTTGTGTAACCTCA
GAATTTTTGTATGATTACACTTGCCTGAGTTAATGTCCAAGTGGATTCTTACCTGATTTA
AACAGATAATGCGTGATTGATGGATTGAGATGCCCATTTGGTCAATAGGTCAATCCTCAA
GGTACCGCATGTGTATTGAAGGCTTAAATTTGTGAGAATGGGTTCAGGTTAAATCAAGCC
AAAGACAGATGCATACCTGGTCCTAATTATTTTGCCCCTTTTCCAATTATCTTTTGCTCA
TTTGGATTAAGTTTGGTCGTACTCTTCAGCTGGTATAAGCATAGAGAGACTCTAGTGGTT
ACTAATATAGTTTGTGCTATTTCAATTTTCGAAACAATCGGACTACTCATGCTCGTAGCT
CTCACATATGAAATGGGAGTCTACTCCTCTTTCGCTCTTTCTTTAATAGGCTTAATTTTC
CTATATGGATCCAATGCATTTTTCGCCTTAGTATTTTTAAAGCAAGTTTCTGGAGGAGAT
AGTGCTTTTAAATATTGGGGACTGACTTATACAAATACTCAAAATGCCACTGTTGCTTTA
GGATCTATGCTTAATTTCAAGCTCTACAGAATCATATATGGGAAGTTATTTGGAAGAGAT
CAGTTTAACGCAGCATTTGATGAACCAGAACATTTCTTTAAGCCTTTTACTTTCGTCTCT
GTTTTCTCATTAGTAACTACTATGATACCTATCTTAGTTGCATAGTTAGTACTTTTGGGT
CTCATGATTCATGAAAAAATTAAGTTGAAATCCTATGCTTTGAAGCAGCAGAAATACTTG
AAAGTAGAGCCAAAATACTTGGACAACTCTTCTCTAAACGTGATGTCCTCATTAATTGAT
GAAAATACGAACAATTACTCGATGATGAAACCTTAGTCTCTGCAAACCGCTCAAAATAAT
TAAACTTCTCTCTATACTTCCACTAATACTGCTTAAGATAGAAGAAAAAATAAAACCGCA
CTCACAACTGCAGGTGACAAGATCGATGCACATAATTACCTTTCAATGACATAAAATGCA
ATAAGTCACGATTAATAAAAGCACAAATATGAGAGTGCTGAATTTAAGGAGTACTTTGAA
CGTAGGAGAATGTTAGAGAGACTTATATCCAATATTTATAATAAAAATCCCACCACTAAG
AATAAAACTGATACAGTAGACTTAATAACCAAACTCCAGGAAGATGAAATGCTAAAGATA
CAAAATAGAGTGTGTAGATCTTTCAGAGACTTAAGAGAATTTGATGATGATTTCGTGGAT
TAAGGAGCTGGAGACCCTGAACTCCAAAACTTCATATCAGCTCCAGTTAGCCCAAGAGAG
AAGGAATTGCTGCACAATCCGTTCTTCCTAGGAAGAGTGGAGCTATTCAAGAAAGCAGTA
AGACTCAGGAGAGATTAGTACGACAATTGCTATGCTGAAGCCAAACCCACTCATTACTTC
CCGATGAGAGACACCAAACTAATCAGTGTCAAAGTACAGACAAATCTTTTGGAATTACTA
GCAATTGATGATATGATTAGAGCTAAGACTAACAACTTCAGACATCACGATTCCTCAGAA
GAAGAGTACGTGGAGGAAAATCTTAACGGAGACTACGCATCAGGGTTGATAAACAACGTG
CTGGACACGCTAAAAGATCATTAATTCACAAAGCAAAGACGCAGACTGCCCAGATCCAGA
CTACAGTAGATTCCCAACTTTGATCTTAGCGACATCACTGGTGACTTTGAGATTGATAAT
GAAGGCAACTGCTTGATTATTAGAGGTAAAGACGGCAAACTTAATGATAGAGAAGGCAGG
AGAGTGAACAAACGCGGTTACTTGATAGATAACGAAGGCAACATAGTAACAGCTGGCAGA
AACATGATGATTTTCCGTGTGGACGAGTTGGACAGTGACGATGAAATACCAGCTCCATTT
TGCTTCGAGAAAAAGAAGGAAAGTCTCTTCAAGATCGAAGGAATCCAAACTTACAACCAG
AAAACTAAAAAGAAGAATATTATGGACTAAGAAGACGAGATTGAGAGAGAATACAGGAAG
TTGAGGGAGAAAAATGCTTCACATTAGAGCTCAGTTGATTCTTTGATGGGGGAGAACCCA
AGCAAGTATAACAAAAAGAATCAGAGACGAGTTATGCCTGGGGATGAAGACGGATTTTTG
AGTAAAATAGTGCAGCCTATGCAAGCCAAAACTAAAAATGAGCTTCTCAAATAAGGTACT
TAGTAAGCTGCAAAGTTAAACTAAGCAGATAATGATAACTTACTTGAAGGTCTAATTAAT
CACTAATCAGCCAAGAAGGTCTCTCCACTTAGAAACAATTAAACTTCCTCTCGTCAACAA
AATCTCCGTTAGCAAACCATGACAAGTGACAGTGGAATCATAACAAGGGAAGGCTCTCCA
TCGAGATAGTTTAATCAGTAGCAAAGACAATTGACTAAGAATGCAACTGGTGATATAGTG
TCGAACTCCTTTAACAAACCTCCAATGTCTATAGGTGGATATGAAACTGGCATCAATGAG
AATTATGATAGTGAAGCCACAGGACCTCAAGATTTGTTCTTTTCAGGTTTTGGTTAGTAA
AATAATTTCCAATTTGGAATTGGTCAATCCCGTATGCATGGTAATAGCGGTTTGGCCAGA
CCTAATTTCCATTCAATAAGTAACACCAGAAACCCAAACACAACTGGAGGTAGACTCCTA
TAGCAATCAACTATGAGTCAAGATGGGTTGAATTTCACCATGGCCAGAGATAGAGCTAGC
AAATTAAACATGCTAAAAGATACACTTGGCTCGACATAGGAAGATATGGCATTGCTTAAG
TAGTTGCAGAAATTCGAGTAGAGTATGATGGGTAGGTAATCAGCTTAATAAGAAGTCAGT
ACTTCCAAGTCAACTCTCGCAAAGAAAAATCTGTAAAAGGTATATGGAAAAGTATTCGAC
TAGCAGCGCTAAATAGCTTAAGACACAATTTCCTCAAATACTGGGATGTCATTCCACAAG
CCTTCCAGACCACCGAGACCTCAAGTTCAGTCACTATTCGAAGAAGACAATCAATATAGA
TCCAATAAGAAACTCAGTGGCACTGGCATGTCCATCCTCCAAAATATGGGTAACACAGGT
GACTCTAGAATCAAGAACTTGGAGAATATCTATATAAAAAGTGTGAATTAAGAACGCAGA
ACTGTTTCATAGTTAAATAAGCAAAGACATTAACAGTAAATTATGAGAAATCAGCATTCA
GCTTGGGATCTTGATCACGGTTTTAGTTCAGGTGTAGCAGGAAATGGTGGCACTGGATTG
ACAAATCACAGACCTCTTTAGCACAGCATGGTGGAAACTGGCATTGAATCGAGCGATTAA
GATGAATTAAGAATGAGGTAGTAACTTGATAAGATGCAAGCAATTATCGATAAGGGACAG
CAGATGACTAATGCTAATTCCAAAAATATTAAAGTGCCAAAAGCTAACAAAAATCTTTTT
AATGGTGGATGGGTCTGA


>Contig1229.0.g112(protein)
MKFMIGAQLDFVGVQADPSIVGETTANLYVQTTLKTQVPSGGFLKIILPSTNEVAIKQGS
LTCSITGDVTQTGLTCTASGLSITVTTKATISAFATIQVNVQNAFQTPSSSQETSSFTFA
SLATDGTTILDILNAGITLIVSPDTFTSTTITQIDSTVVGSTTSVLVSLVNQNTILAGSR
LRLIFPKWNPAASSSQIVPIVANPTSVTCTQRTNVNSNVKCSFDTATDSLNIIDGFPSGL
NAGTQIQFVISNLRNPLSFAPVSIQVQSLNSAGTGIIENGSIKFAPSIPATISATTAKTS
ADLTTVQEYSNFRLEFQNPVPLNAGTIVTVVFPSQFSFEQKLAAVQGFGLFGSIKNLAYQ
ADSSSLSVKLTSAAIDSYKQSGIAAILTFQQVKNPSVVRASDSFSIYLTDINGYQIAQAT
TGIAYTPTSGSISGVSVEMAEKSINQMGSFVLKFQPLHILTTSSILQVQLPTNLDVSCTG
LKVSGGLSSSITCTEGANNLFTFENLFSTQYTFSSSNFLTLTFANVKNPGSAQQIKSLSI
ATFEKIVVVGGPQNFAVDAYSDSSIVLYTTTASQFKSQSIEVSTNETYTDATFTITLVQD
NQIPQNGILVIVIPSEITIVSSAKCTGITNLQSSLTCSQSGNNLTITNGFSSGSKPENST
LKFSISGLRTPLTTQTSSTFQVYSKDSNSQFIDQVQSLLTVTMLVGKKITTMSALSDSNI
VADSATLSITVKPTMPLKNGDIMYFTIPSSITLPLKSALTCTGADALKATTLSCTTNGQI
LIVTVNLNTSPSTPNSSVLTVRVKTILNPKSTKPTAEISLIVRDSKDYEIGQSSTGTGAI
IVVGTPASITTGTLTPLDYRQKAYTAMTIKFATLNPIPSGGYLQVEFDQRYFSVTKDSSF
KCTSSLVKNVEVTCEFTRDSVFLVKDIFPKDLSSSQQIDFTINNVNINYETKTTATPSWK
VTSMTSDGFMIDKIDNVLTLSFPCNVPCLSCLSNNPNYCLSCNTLTGSTILYNNKCLNQC
PDGLFYNQDKFQCDTCVTTCKTCNPYNPNECLSCNINSPLYPYQLGNTCTDQCPVGFFSN
NKTAACEQCQSPCATCSGSANSCLSCDESNGFKLKYNDKCYQTCPTGTFADDNNQCVKCD
SSCLTCQTSATFCTSCPSNKLLSLYENNCVDTCPFGQTILNSGKKQCDTCDPKCLTCEKS
TTFCTSCAQSLNLIEKTGVCTGECSSDKKTVGFNGICTPCDTKCATCVNNPTSCLTCVTS
EFLYDYTCLSQCPSGFLPDLNRQCVIDGLRCPFGQQVNPQGTACVLKAQICENGFRLNQA
KDRCIPGPNYFAPFPIIFCSFGLSLVVLFSWYKHRETLVVTNIVCAISIFETIGLLMLVA
LTYEMGVYSSFALSLIGLIFLYGSNAFFALVFLKQVSGGDSAFKYWGLTYTNTQNATVAL
GSMLNFKLYRIIYGKLFGRDQFNAAFDEPEHFFKPFTFVSVFSLVTTMIPILVAQLVLLG
LMIHEKIKLKSYALKQQKYLKVEPKYLDNSSLNVMSSLIDENTNNYSMMKPQSLQTAQNN
QTSLYTSTNTAQDRRKNKTALTTAGDKIDAHNYLSMTQNAISHDQQKHKYESAEFKEYFE
RRRMLERLISNIYNKNPTTKNKTDTVDLITKLQEDEMLKIQNRVCRSFRDLREFDDDFVD
QGAGDPELQNFISAPVSPREKELLHNPFFLGRVELFKKAVRLRRDQYDNCYAEAKPTHYF
PMRDTKLISVKVQTNLLELLAIDDMIRAKTNNFRHHDSSEEEYVEENLNGDYASGLINNV
LDTLKDHQFTKQRRRLPRSRLQQIPNFDLSDITGDFEIDNEGNCLIIRGKDGKLNDREGR
RVNKRGYLIDNEGNIVTAGRNMMIFRVDELDSDDEIPAPFCFEKKKESLFKIEGIQTYNQ
KTKKKNIMDQEDEIEREYRKLREKNASHQSSVDSLMGENPSKYNKKNQRRVMPGDEDGFL
SKIVQPMQAKTKNELLKQGTQQAAKLNQADNDNLLEGLINHQSAKKVSPLRNNQTSSRQQ
NLRQQTMTSDSGIITREGSPSRQFNQQQRQLTKNATGDIVSNSFNKPPMSIGGYETGINE
NYDSEATGPQDLFFSGFGQQNNFQFGIGQSRMHGNSGLARPNFHSISNTRNPNTTGGRLL
QQSTMSQDGLNFTMARDRASKLNMLKDTLGSTQEDMALLKQLQKFEQSMMGRQSAQQEVS
TSKSTLAKKNLQKVYGKVFDQQRQIAQDTISSNTGMSFHKPSRPPRPQVQSLFEEDNQYR
SNKKLSGTGMSILQNMGNTGDSRIKNLENIYIKSVNQERRTVSQLNKQRHQQQIMRNQHS
AWDLDHGFSSGVAGNGGTGLTNHRPLQHSMVETGIESSDQDELRMRQQLDKMQAIIDKGQ
QMTNANSKNIKVPKANKNLFNGGWV