Identifiers and Description

Gene Model Identifier

Contig21445.0.g92

Standard Name

LSF1k

Aliases

Contig21445_0_g92

Description

Protein of unknown function (DUF3659)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam12396 ) Protein of unknown function (DUF3659)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000392607.001072473260973e-36hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig21445.0.g92(coding)
ATGTACTTATTATCCTATAAAGTTGCTTAAACTTTATTTTAGTATTCTTTGATTAATTTT
AACACTAGATATACTGGACAAACTGCAACTGCTACTGTCTCAGTAAATCCAACTGGATTC
ACATTTTAAACAGGAGATGAGATACGTTGCACTCTTAGTAACTCTCCAGGAACTCTAGAT
AGCACAAAGACTTGCTCTACCCTTGGATCTTCAGCATATACCACTGCATGCACATTTATC
TCTTCAGTCAAGTTTGTTGGAACTGTGACCATAACAGGATCAACACCTTCCTAAGCTAGA
TTTACCTTGAACAATGGATATATAAACCCATCTTCATCTCAGACTATCAACTCTGTACTT
ATTGAAGTTTACAGAGGTGGTGTTCTATATGGATCAAGAACTACTTCTTCAGGGATTCAG
TTCATCCCAAGCTTGATGACATCAGCAACTTTGACAGCTACTTCCCCTATAATTGGAAAT
ATAAACTCAGGACTAACAGTTACATTCACTCCAACAAATTACCTACCAGTAGATGGATAT
GTAGTAGTGACATTCCCTGATTTTACTTCAGTCTCAAGTACTGAACATATCACTACTACC
TCTCCAACTTGCACTAATGTTAACGGTATGAAATCCTCACTCACTTGTAGTTACGCCAAC
ACAAACAATACTTTATCAATCTAGAATCCTGTGTCATCATAAACTAAGGGAAGCTCTTTA
TCATTTACAATCAACTCTTTCAAAAATCCTTACAATGGGAAGCCAAAATCAGGATTTAAG
GTTACGACCTATGATAGTAGTTACTATTCTATTGATGAAATAGACAGTCTTTCTGTCACA
GTCACTACTTTTGCTGAGTTTCAAAGCGTTCTAGTATTTAGAGACGATGACATAGAAACA
GTTGAAGAAACTTCCTACATCTACTTTGCCTTGGATGCAAGATTTCCAATAGATGCCAAT
TGCAAATTGCGCATTGATTTCCCAACTGAGCAGCCTTACTCAGATGATTTAGTATATCTC
TATGGAGATGATAGTATCGTAAAAACAGAAGGAAGCAGCTCCATTACTCCTTACTCATCA
TCTAACTACATTGAGTACACAGGATGTATAGACTATATTGATGAATCTAAAAGTTAGGGC
ATGCTTATATACATGGAAAATGTTCTTAATGCTGCTAAAGTCAAAGATACAGATTCTTTC
AAAATTACTCTATATGCAATTGACTCAGGAATTACCTATAACATTGCCTAAATCACCTCA
GGTGTGATAATTACTTAGGACATGCTCTCACCTGGTAAGATTAAGTCCCTGACTGTAGTT
GCAGATGACTCGACAGTATCAACTGCGACTTTTTACACAGTGACAATCCAACCAACGCAT
TCAATTCCCAGCGCATCAAAAATTAAAGTCAAATTCCCCACGTCACTAATCCTATAGAAT
ATCGTATGTACCATCACTACATCCACTACTCCAATCAGCACATCAAGTAGCTGTGCTGTA
TCATCTAATGAGATTACTCTAACTAATCCGTTTGGTTCAACTGGCATATTCTCCAAAGGA
GGTTCAGCCTTCACATTTAAGTTCAGTTCAGGAGGTACCAATCCTGATTCGGTTAGGGAT
GCGGGTACTTTCGAAGTTTAAACCCTTGCTACGGTTGGTGGAATTGACTACGCTATAGAC
TACACAAGTTTCACCGGTATCTTCACCCCAACACCTGCAGTGCTCGTGGCAACCGTGGCA
TCCAGCTCCCTTGTGGCCTACGCAAGCGGATCTACCTATACTTTTTCGATTACTCCGGTG
AAGACAATCCCAGCTGGAGGACAGATCGAAATTGCCTTGTCCACCGATGTCTATTCAAGC
GCTCTAACCCCATGCACCATCACCATTTCAGGAGTCACTACTTCTCCTACCTGCACCTTC
TCTTCGTCGAGCAGCCCACAAAAAGTTGTCATTACAGGCGCTTTTGCTTCATCTTACACG
GCAGCTTCTACGGCAATCACGGTGGCGCTAACTGGTATAAGAAATCCAAGGACCACCGCA
GCATCGACTACTTTCTCAGTCAGCACAAAAGACTCTTCTGGATACGCTATTGCTAGTCAG
ACCACTGGTATTACTGTCACAATGACAACGGTGCCAAATTTAAATAGTTTTGCAGTGGCA
TAGGCCAGCTTAATCAACGGTATATCTAACGCGTATACATTTACAGTGAACTCTCCGATC
CCTCATTACAGTTCGGACAAGATTATTTTCACCTTCCCAAATGATGTGGTCGGACCATCT
TCCCCTACTTGTACTGCTTCAACTAATGTGGCAACAGTGACATGTTCCGCTCCAACTACC
AACTAGATTTAAGCCATTTTTACATTTTCTGGCGGTACTTTACTTGAAAATACAAGTTTC
ATTTTTAAGGTGAACGGTGTAACAAACCCTCATAGTACTGAGCCAACAGACGCATTTACA
AATGTTTAAATGCAAGACACTGCCAGTGGAAAATTAACTGGATTTGCAGGGACAGTTGTG
ATCACTGACACCACCCCAACCACAATTTCTACCACTGCTCTAGCACAAGTAAGCAAGGCT
TTGAATACAGCAACTACTTACACAATAACATACAGTACTATGAACAAGCATGAATTGGGA
GGAGCTTATGTGATAACTGCTCCTTCGACGGTTACTGTCGCAGGCACATTGACTACTTGT
AATGTGGTCTATAGTGCGGTCTCTTATCCAATGAGTTGCAGCGTGAGCGGTAGCACAATT
ACAATAAGCACTGGATTTGTTCAACCAGTAACTAAGGGTGATTCAATTTAAATAGAGCTT
GGACCAATAACTAATCCTATTACTCAAAGTGGATCAACTGCCTCCTTCTCTCTGCTCTCT
TACACTGATACAACTTTCAATTTCAAAATTGATACTGTGTCTACGGGACTAGTTCCACAA
TTTGAATGCAACTATCCATGTGCTTCTTGTGAGACTACTGATAAAGATGCTTGCCTTAGT
TGCTTGACTTCACCAACAGAGTTAACTTATCTGTACTTGTACACAACTACTAAGAAGTGT
CTTGATGTTTGCCCTTCTGGAACTTGGAATAATAACTTCTTATGTACAGATTGTACTTCC
CCTTGTAAAACTTGCACAAGTGCCACAAACTGCTTGACTTGCGATACAACTAGCAGTTAT
CCGTACTTTTAAGATAATACTTCACCAACCGATGACACATGTGTTTCAATTTGCCCAAGT
GGCCAATGTGCAAAGCTTTTCGTTTGCTAATCAGTTTGCTCAGTAGAAGACTTTAATAGT
GTCACAGTCGTAGCAAGCCCAACCACAGTAAACTATGTAGGAGCAACTCTTACCCTTACA
GCTACACTGACAACTACTTCATCCACTAAGTCTAGTTATGCAACTGGCGACATTTTGTAC
TTTACATTCCCTGCAACTGTATCATTTACACCTTCAACATTAACGTCTTTGTGTACAGCT
AACTTGTAAGATGCGTTTGGAGCATCTACTTCAGTAACTGTTGCTTCATGTTCAATAAAT
GCTCAATCTGTAACTCTAAAGCTCGGTACGATTTCAACAACTGTGAATAAAGTAGTTCTG
ACAGTCGGTAACTTTATTAACCCAGCATCCACTTGTGATGTTAGCTCTGTGTTGACTCAA
TTACTTGATATTACGGGTACAACCATGGTGTAATACTCGAGTTCTACTATTAGTGGATTT
ACAGGTGGTACAATGACCACTGCTGCTTTGACTTCCAGTAGTTAGGTTGTAGGAACTGAC
GGTAATACTTTATCAGTACTATTTAAAATTGCCAATGCCATGTCAGCTGGAGGTACTATT
GCTTTGACTCTTCCATATTGGAACCCTAGTTCAACCACAAAAATTCATCATTTGACTTCT
CCAACTTGCACAGGCACATTTACTCTGAGTGGTCCACTCACCTGTACTTATGATTCTACA
ACTAGAATTCTTACTGTTACAAATAGTGCAGCTAGAACTGCTGGAACAACATTAGGCTTT
GAAGTTACAGGCTTTAGAAATCCATATAATGGTATTCCAAAAAGTGGATTCAGCTTGGCA
ACTTATGATTCTTCAAGCTGTAATATTGAATCTATCAGTTCTCTTACGGTGTAAACTAAC
ACAATGTCTACTCTACCATCTGCTTCGTTTAGCAGAGCAGATACTTAGACAAAAGTTTAA
GAAGCATCAGCATTTACTGTTACTTTTGGAAACGATTTGCCTGCTGACATTAATTGTAAA
CTTATTATTTCGTTCCCATCAGAAATGCCTGTAACCACGGACCTTGTTTCATATGATAGC
GGTACTAATCTAATGAACAAGGCATCTAGCACCCTCACAGCAACAGGTACAGTAACTGGA
GTGGGTTCCACAACTACTACTGCAAGTATCCTAGGCTGCTCAAGTTACAGTGAAAGCAGT
CTGACATCAGTTGTAACATTAACAAAGTTATTCAATATTGCTTATGTGAAAGCAGCAACA
CCCTTCTCATTGAAACTCTACGCGGTATCAGGTGGTGTTGACTATAACATAGCAGAGTAT
ACTACTATTACTGTTGCTAGTACTGAGTTTGCCACTGGTGCCATAACTACATTTACAATG
ACTGCGAGTACTTAAGTTGTATAAGAACATGCTATATATTAATTAACTATTTAACCTGCA
CATGCTATTCCCTCTGACTCAAAGATTAAAGTGACCTTCCCCTCATCCATGACCTTAGAC
ACCACATCTTCTTGTTCTCTGTCCGCTGCATCCGCTGTCTTATCCCCTATTGGTTGCAGT
GTCTCTGGAAATGTCCTTACTCTAACTAATCCGTTTGGTTCAACTGGCATATTCTCCAAA
GGAGGTTCAGCCTTCACATTTAAGTTCAGTTCAGGAGGTACCAATGCAGCAACAGTAGGA
GATGTAGGATCTTTCTAAGTGCAAACGTATGCAACCATATCAGGCACAGATTATGCTGTA
GATGATACGACATTCACTTCAGTATTTACAACAAAAGCATCAGAACTTGCTCTTAAAGTA
ACAGCTGTGTCAACCTATACAACAAGTGCATAAAGCCAAGAATATACTTTCTAAATCACT
CCTAAAGTAGCTGTTGCTTCTGGTTCATCTCTTGAATTCGTGTTCCCAACAGAGATTCAA
TTGTCTGATGGTGTTACAGCAGCTTCACCAGTGACTACTATAATCGGAGGTGTTACTACA
GTACTAACTGATTGTACAACAACTACAGTGAGCGGAAAAGTAAAGGTAACTTGCCCAAGC
GCTTTTCCAACTGCCTACACAAGTACAGGTACACCTTATATTATAAAGATAGGGGGAATG
ACTAATCCAAGAACTACAGATGAGACCTCATCATTTGAGGCATCAGTCAAGTCATCAGCT
GGTGTTGAACAAGAGTCAGTTTAAAGTGGTGTCACAACTCAGATGTCTTCAAACTCTGAT
ATTCCAACATTCACAGTAACACCTGTCAGTGTTGTGAATGGAGCTATCACCAATTATAAA
GTAAGCATCAAATCAGGCATCAAGCTTGTGACTGGCGATCAAATATCTTTTACACTTCCA
ACTGAAGTTGGATTTTCCTCTGGAAGTTTCTCATGCTCAGCAATAAGCAATCTAGCTAGT
GTTTCCTGTAGCAAAATCAGTTCAAATACAGGTGTTAAAGCTATATTTACATTTACATCT
GGATCTTTACTTAAAGATAACGTATTCGAATTCTTGTTAAATAACATGCAAAATCCACCA
AGTACTAAGACATCTACAAGTTTCACAGGAGTAACAATGAAAGATACAGATTCAAAAACA
CTAGAAACCTTCTCTAGTACTGTAACAGTTACCAACACACAACCTGCTGCAATAACAACC
AAGACTCTCGCCTAAGCTGATGTGACTAATGGAGCATCGACAACTTTCACAATAAGTTTC
ACTAACATAAACAAAATGAGCACTGGATCTTCATATATAGTTAAGTATCCATCTACTGTG
ACTGTTCCTACAACTTTGACAACTTGTTAAATGTAAGTAGGTACAACAACTTATACTCCC
ACTAGTTGCATTGTGGATTCGACCACATCCTCCATTAAGATCTCTGGAGGTGTAAGCACT
GCAGTAAGTGCTGGCTAAAGCATAAAGATATTATTAGGTGCAATCACAAACCCAAGTGTG
TCAGGTGGAACAGAAAGTTTCACTTTAATCAGTTATACTGACAGTACTTTTACATATACA
TATGATGAGATAACAGGTGGCTTAATTCCTAGTTTTGGATGTAGCGTTCCTTGCAAAACT
TGCTCAACTGTTACTACAACTTCTTGCTACTCATGCTTCACAGATATCTCTAGTATCCTC
GAGATGTACCTGTATAATGAATAGTGTTTGACTGAGTGCCCCACTGGATACTATCCAGAT
TCCTTTAAAATATGTAGAAAATGCGATTCAAGATGCCTGACTTGTCAAAACGGAACAGCT
TGTTTAACATGCAATACAACCGGCACCTATCCATATTTCAACAGTGCTGATAAAATGTGC
TATACTACTTGTCCAGATGGCTTATATGGAAATTCCTCATACTATTGTGAGAATTGTGAC
TCTAATTGCAAGACTTGCTAAACTAACTCTACTTTTTGTAAATCTTGCTACTCAGGAAGC
ACTTATCCATTTTTATTAAGCAATAAATGTGTGACTAATTGCAATTCTAACTAAGTCAGC
GTAAATTACACTTGTACAAACTGTACCTCTCCATGTGCAACATGCTTAGTGTCAACCAAC
TCATGTGCGAGTTGTAAAACAGGCTTCTAATATGGAACTACTTGTGTAACCAAATGCCCA
TCCAATACCATTTTACAAAATACTAAATGTAAAGGTTGTGATCCTAACTGTGGAGTGTGC
AATTAGGATGATTTCACTGTGTGTGACAAGTGCAAGACTGGTTACTTCATTATCGACGGT
GCTTGCTTCCCTGGATGCCCTGATGGCTATAAACCCTCGTCAAACAATGTCACTTGCGAC
AAAGTAGTCTAATAATCTAATTCAACAACAAACGATACAAACACAACAGTATTTGACTAC
GTAGGTTTGATGGCTTATTTCCCCCATACCGCAACTTAATCAGTTTTAGGCCTTTCCGTT
GGTGCTGGATGGCTTAAAAGTACTGCAACTATTATATCAAGCAACTGCATTGCACTCTGG
GGGCCAGTTGAGTTTATCAGCATGGGATCTCAAACATATCTGAGTTATAACTACATGAAT
GCACAAAGAGATGCAATAAATGGAACTAATTCCACAAGTAATATGAGTATGCTCAATGTT
ACTTCAGGAAGAAGAATGCTGTCTTCAAATTATGTTTTAGAAGAAGACCCTGGTGGAATC
TTACCTCTTGTGTTTTATGTGACCCTCTTCGGCTTCGTAGTAAAGTTGATCATGAACTTA
ACGTTCGGTATTCTCTTCCTGACCATGATAACAAAAGACCCTGGCTACCAAGAATTTAGT
GAATCTTTCAGATGGACTCCCAGCATTATAGCAGCTCTTGGTACTTTCTTTTCTTTTAAA
CTGTATAAACTTTACTATTCAAGATGGTTTGGAGCTTAAAGATTCTACATACCTCTTGAA
GATCCCTTCAAGATACATAACATGTTCAACATCATGACTGTTCTAAACATTCTTTTCACT
ATTTTGCCAATTATAGCAGTCGATATTTATGGTTTGTATTACTATAGATGGGGAGGTCAA
TTCTACATCACTATACTTGAAACATTATTCATAGCACTTTTTATGTTGGCTCTGCAACTT
TATGAGCTATGGAAAGTTAAGAAAATTTTAGAACCCTCTGAAGCAAAACCATATACATTC
TTACCTGAGGAAGTTGCCATTGCTGAAGATAGAATCATGAAATTATTTGACGAGAGAATT
AAATCTTTGTTCCCTGGTAGAGATCTGGAGAGTTACGTCAATGAGCTAAGAAATCAGAGA
GGTCTCAATAGTGATAACGAAGAAGAAAAAGAGCAATAACTATTGCTAAAGAAATCACCA
AATAAAAGGAAAGACATTGATGATGTGAACATATTTAGTGTGCCGATTGGATATGATGAC
TATCCAGACAACTGTTATGCAGAGCCTGGTACACTTCCCAAAAAGACTCTTAATCCTGAT
TAAATTGAAACAAAAGTTTAGCAATATGGTCAGCCATTACAGTCAGGCTTAGAATATGAT
AAAGATTTCAACTCTAGATTTAGAGCAAAAACTCCAGATAATATAGACCTTGCTAATTAG
AGAAACTCTCAGCGATTCAACGGAGGCATTGCAACATCTAAGGTCGATGATGAATTATTG
AATTCATCGCAGTAAAACAAGAGAAAGAAAGAAAAGAGCAGTAAGAAGAGAGGTAGAAAG
GATAAATTCCAAGAGAATATTGACGATGATGATGTAAACTTACTCAATCAAACAGGCATG
AATGATGACGATGGTCTTGGAGATAGCATGCTCCTTAATGATAGCTAAATGCCTCTTAAT
GATGTGAATAAACTTGATAGCATTTAAGAAGAGTCACACATCACAGAAAATCTAAAGAAT
TAGTAAATGGATATTACTGAGAATCATTCAGAACACAGTCATTAAGAAACTGAGCTCTTT
GAAGAAGAAAATGCTATTAATGGGCCAAATCAAATGTTTGACTAAACAAAGAAGCCAGAT
GAGGATCTTAGTAAACTTGAAGACGAAATCGATCATATTGACCCCATTCTTGTTAAACCA
GAAAACCTAAATGATGAAGAAACCTACAGATCACAGATTCCAAGTGAACTTGGTGAGCCA
GATAGTGATGATGATGAAGACACTAGAATATAGAACATGCAGGATCCTGAAAAGAAAAGA
TTCAATGTTAATGATGTATTTGGTCAGTTTGACTAGGACGACAAAGGAAACCCAGTGATT
CTGCAAGATTAAAAGGGAGAACTTATAGATAAAGATGGCAATAGAGTAAACAAGAAGGGT
TATTTGATTGATGAAGAAACTGGAGACATCGTCGAAAGAGAAAATGGCAGGAAGATATTT
GACTTCAATGATTTGGATGAGCGTGGTGAACTACCTGCACCTTTCAACCTAGAAAGATTT
AACTTCAACATTCATGATGTCAGAGGCTACTTCGATAGAGACAAAGATGGCAACGAGATA
ACCTGGAATAGAAAAGATGGCGATGGAAATTAAATCGACAAGTTAGGCAGAAGAGTCAAC
GAGCAAGGATACCTTGTTGATAAGCATGGCAATTTAATTGATAAGAGAGGGAGAGTCAAG
CTAAACAAAGAAATCATGAATAAAACAGGCGGTGATGTGCCTCTCCTGTTCAACTATAAA
GGAAAGAAATTCGACTTGAAGGATGTCATGGGAAGTCTTGATAAAGACAGAAATGGCAAC
TTCATTATCAGAAGAGACAAAGATAACAATATGGTTGATAAGAAAGGCAGAAAAATCAAT
AATAGAGGCTACTTAGTTGACAATCAAGGCAATGTCATAGATGAAGATGGAAAGATTATA
TTCGAAAAGTACTGTCTCTCTAAAGACAATGAAATACCTAAGCTATTCCCCTTCCTAAAG
TTCAACATTGACGACATCAAAGGTGACTTTGAAAGAGATCCAGTAGGCAACCCTATACTG
AAAAGAACTAAAGATGGTTTTGTTGATGACAAGGGCAGAAAAGTAAATCAGAAAGGGTAC
TTGATTGACAATAATGGAAACATTAAGAATAAAAAGGGTTTCATGGTGTTCAACAAGCGC
TTATTGGAAGATGATGGGGAAATACCTAAGATTTTCAGAACAGGTTTATTGAGAAAAGAT
ACTTAAGACTCTCTTGCACAACTCATGGATGAAATTGAAGATTTAGAGATAATTCAAGAC
CTAGACCCCAACGATCCTCGTAAGAAATCTACTTTGAATAAACATGCATTAAGTGAGCAT
CAAAGAATGTAAAACAAAATTGATTAGATAGTAGAGGAAGACTTTGATGATGATGATATT
GCAAGAGAAATTGATCAACTAGCTGGAGACTAGCCTTTCTCTGAAGGTGGAAATACCTCA
GTGGATTCATTAATGGAGGATACACCAAGCAACTACAATGCTGCAAACTAAAGATTCAAT
GAAGTAGAAGCTATTAAAAATAAAGCCAAAAGAAACATGCAAAGGCAGATTAAAGTTCCA
GAAGAAATTGAGTTAGAGAGTGAATTCTCATACATGCCTGACAGGAAAATGAAAAAAAAG
AAAAAGAAGAAGAAGAAAACAAAGGAAGCTATTGATATAGACAGGGAGTTACTAATGGCT
AAAGCTTATGGTGGCATCACCTAGCAATAATACGATAAATTGCTTGAGATGAAAAAAATG
AAGGAAAAGTAAAATAGTTAATTAAACTTAATGCTAAATGCGAAACCTTCAACTATCATG
AGAGAAGCTTCTAACACTAAGATGTCTGGTATGTACAAGAAGCCACCCTAAAATCCTAGT
ATGATGAATGGTGATGATATGACCTCTGAATTTGGAGGAAATGGCAGCTAAAGAGATGGA
ATGACAGTAAGAGCACGACAACCCTCAAGAGTAAAGCGAGTTGGTGGCGGTTTTGCACCT
CCAAAACTAGACAAAGACATGATCTCAAACAAGAGTATGATAAACAAGCCACTAGATATA
TAAAAGAACAACTTAATGGGTGGCACCACTTAACTCGATATAAACGGGATGGATGGTAGA
TCATAGATTTCAATGGATGAAAGGTACAAGTACAACTTGAATGGATCAAAGCCGTCAGAA
AGAGACATGAAACTTGCCAATATAGCTAATTCAGTCAGTGGATTTTACAGAGACAATAAT
GCAAACAGTAATTTCGTGCCTCAAAGTGAGCATTCACGCACACAGGAATCTTAATTCGCT
TAGAATATGCCAAGAATGCTAAATCAAAGGGAAAGTGAAGAAAACACTCTTAGAATGGAA
GATCTAGAGCGGATGAATGGTACTGCGAGAAGACCTATGGCCGGAGCCGATCAAACTCAA
TATAGCGACTGGGATAACTAGAGTAGATAGAGTGGCAGAAGCAACTAGAGTCAGTTTAAG
TCAAAGAACAAATTAAGAGTTAAAGGTCTTGAATCCATTTATCTCCAGAGATTGGAGCCC
ACAGTGAGAGCAAGATAAGCAGCTCCTTCACGCAAAACAGATGATAAAACAAAATTCAGA
GTAACTTAAACAAACAAGTTCTAAAATGAGCCTGCTCTCTTCAATGATGGCTATGGAGAA
GAAGATGACAGAGATGAATTAGAGTCAGTAATTTCAAACAATTACAACTAAATGCTTTAA
CAAGAATTCAGAGGTAAAGATGGCACTACCAAACGCAGAAAGAAGGGCAAGAAAAGCAGA
TAAGTTTCTTAAAACTAAATGGGAACTATAAATGGAGGCGGAGCTACTGGCACATTCCAT
AACAATGATTCACAGCAGGATATGTTTAATGCACCCAATTTATTCACTGGTAATTTTAGT
CAGGATAAGGACAAGAAGTTCAAGTCATAAGTTCCAAGTTTGGATTTTGGAAATTGA


>Contig21445.0.g92(protein)
MYLLSYKVAQTLFQYSLINFNTRYTGQTATATVSVNPTGFTFQTGDEIRCTLSNSPGTLD
STKTCSTLGSSAYTTACTFISSVKFVGTVTITGSTPSQARFTLNNGYINPSSSQTINSVL
IEVYRGGVLYGSRTTSSGIQFIPSLMTSATLTATSPIIGNINSGLTVTFTPTNYLPVDGY
VVVTFPDFTSVSSTEHITTTSPTCTNVNGMKSSLTCSYANTNNTLSIQNPVSSQTKGSSL
SFTINSFKNPYNGKPKSGFKVTTYDSSYYSIDEIDSLSVTVTTFAEFQSVLVFRDDDIET
VEETSYIYFALDARFPIDANCKLRIDFPTEQPYSDDLVYLYGDDSIVKTEGSSSITPYSS
SNYIEYTGCIDYIDESKSQGMLIYMENVLNAAKVKDTDSFKITLYAIDSGITYNIAQITS
GVIITQDMLSPGKIKSLTVVADDSTVSTATFYTVTIQPTHSIPSASKIKVKFPTSLILQN
IVCTITTSTTPISTSSSCAVSSNEITLTNPFGSTGIFSKGGSAFTFKFSSGGTNPDSVRD
AGTFEVQTLATVGGIDYAIDYTSFTGIFTPTPAVLVATVASSSLVAYASGSTYTFSITPV
KTIPAGGQIEIALSTDVYSSALTPCTITISGVTTSPTCTFSSSSSPQKVVITGAFASSYT
AASTAITVALTGIRNPRTTAASTTFSVSTKDSSGYAIASQTTGITVTMTTVPNLNSFAVA
QASLINGISNAYTFTVNSPIPHYSSDKIIFTFPNDVVGPSSPTCTASTNVATVTCSAPTT
NQIQAIFTFSGGTLLENTSFIFKVNGVTNPHSTEPTDAFTNVQMQDTASGKLTGFAGTVV
ITDTTPTTISTTALAQVSKALNTATTYTITYSTMNKHELGGAYVITAPSTVTVAGTLTTC
NVVYSAVSYPMSCSVSGSTITISTGFVQPVTKGDSIQIELGPITNPITQSGSTASFSLLS
YTDTTFNFKIDTVSTGLVPQFECNYPCASCETTDKDACLSCLTSPTELTYLYLYTTTKKC
LDVCPSGTWNNNFLCTDCTSPCKTCTSATNCLTCDTTSSYPYFQDNTSPTDDTCVSICPS
GQCAKLFVCQSVCSVEDFNSVTVVASPTTVNYVGATLTLTATLTTTSSTKSSYATGDILY
FTFPATVSFTPSTLTSLCTANLQDAFGASTSVTVASCSINAQSVTLKLGTISTTVNKVVL
TVGNFINPASTCDVSSVLTQLLDITGTTMVQYSSSTISGFTGGTMTTAALTSSSQVVGTD
GNTLSVLFKIANAMSAGGTIALTLPYWNPSSTTKIHHLTSPTCTGTFTLSGPLTCTYDST
TRILTVTNSAARTAGTTLGFEVTGFRNPYNGIPKSGFSLATYDSSSCNIESISSLTVQTN
TMSTLPSASFSRADTQTKVQEASAFTVTFGNDLPADINCKLIISFPSEMPVTTDLVSYDS
GTNLMNKASSTLTATGTVTGVGSTTTTASILGCSSYSESSLTSVVTLTKLFNIAYVKAAT
PFSLKLYAVSGGVDYNIAEYTTITVASTEFATGAITTFTMTASTQVVQEHAIYQLTIQPA
HAIPSDSKIKVTFPSSMTLDTTSSCSLSAASAVLSPIGCSVSGNVLTLTNPFGSTGIFSK
GGSAFTFKFSSGGTNAATVGDVGSFQVQTYATISGTDYAVDDTTFTSVFTTKASELALKV
TAVSTYTTSAQSQEYTFQITPKVAVASGSSLEFVFPTEIQLSDGVTAASPVTTIIGGVTT
VLTDCTTTTVSGKVKVTCPSAFPTAYTSTGTPYIIKIGGMTNPRTTDETSSFEASVKSSA
GVEQESVQSGVTTQMSSNSDIPTFTVTPVSVVNGAITNYKVSIKSGIKLVTGDQISFTLP
TEVGFSSGSFSCSAISNLASVSCSKISSNTGVKAIFTFTSGSLLKDNVFEFLLNNMQNPP
STKTSTSFTGVTMKDTDSKTLETFSSTVTVTNTQPAAITTKTLAQADVTNGASTTFTISF
TNINKMSTGSSYIVKYPSTVTVPTTLTTCQMQVGTTTYTPTSCIVDSTTSSIKISGGVST
AVSAGQSIKILLGAITNPSVSGGTESFTLISYTDSTFTYTYDEITGGLIPSFGCSVPCKT
CSTVTTTSCYSCFTDISSILEMYLYNEQCLTECPTGYYPDSFKICRKCDSRCLTCQNGTA
CLTCNTTGTYPYFNSADKMCYTTCPDGLYGNSSYYCENCDSNCKTCQTNSTFCKSCYSGS
TYPFLLSNKCVTNCNSNQVSVNYTCTNCTSPCATCLVSTNSCASCKTGFQYGTTCVTKCP
SNTILQNTKCKGCDPNCGVCNQDDFTVCDKCKTGYFIIDGACFPGCPDGYKPSSNNVTCD
KVVQQSNSTTNDTNTTVFDYVGLMAYFPHTATQSVLGLSVGAGWLKSTATIISSNCIALW
GPVEFISMGSQTYLSYNYMNAQRDAINGTNSTSNMSMLNVTSGRRMLSSNYVLEEDPGGI
LPLVFYVTLFGFVVKLIMNLTFGILFLTMITKDPGYQEFSESFRWTPSIIAALGTFFSFK
LYKLYYSRWFGAQRFYIPLEDPFKIHNMFNIMTVLNILFTILPIIAVDIYGLYYYRWGGQ
FYITILETLFIALFMLALQLYELWKVKKILEPSEAKPYTFLPEEVAIAEDRIMKLFDERI
KSLFPGRDLESYVNELRNQRGLNSDNEEEKEQQLLLKKSPNKRKDIDDVNIFSVPIGYDD
YPDNCYAEPGTLPKKTLNPDQIETKVQQYGQPLQSGLEYDKDFNSRFRAKTPDNIDLANQ
RNSQRFNGGIATSKVDDELLNSSQQNKRKKEKSSKKRGRKDKFQENIDDDDVNLLNQTGM
NDDDGLGDSMLLNDSQMPLNDVNKLDSIQEESHITENLKNQQMDITENHSEHSHQETELF
EEENAINGPNQMFDQTKKPDEDLSKLEDEIDHIDPILVKPENLNDEETYRSQIPSELGEP
DSDDDEDTRIQNMQDPEKKRFNVNDVFGQFDQDDKGNPVILQDQKGELIDKDGNRVNKKG
YLIDEETGDIVERENGRKIFDFNDLDERGELPAPFNLERFNFNIHDVRGYFDRDKDGNEI
TWNRKDGDGNQIDKLGRRVNEQGYLVDKHGNLIDKRGRVKLNKEIMNKTGGDVPLLFNYK
GKKFDLKDVMGSLDKDRNGNFIIRRDKDNNMVDKKGRKINNRGYLVDNQGNVIDEDGKII
FEKYCLSKDNEIPKLFPFLKFNIDDIKGDFERDPVGNPILKRTKDGFVDDKGRKVNQKGY
LIDNNGNIKNKKGFMVFNKRLLEDDGEIPKIFRTGLLRKDTQDSLAQLMDEIEDLEIIQD
LDPNDPRKKSTLNKHALSEHQRMQNKIDQIVEEDFDDDDIAREIDQLAGDQPFSEGGNTS
VDSLMEDTPSNYNAANQRFNEVEAIKNKAKRNMQRQIKVPEEIELESEFSYMPDRKMKKK
KKKKKKTKEAIDIDRELLMAKAYGGITQQQYDKLLEMKKMKEKQNSQLNLMLNAKPSTIM
REASNTKMSGMYKKPPQNPSMMNGDDMTSEFGGNGSQRDGMTVRARQPSRVKRVGGGFAP
PKLDKDMISNKSMINKPLDIQKNNLMGGTTQLDINGMDGRSQISMDERYKYNLNGSKPSE
RDMKLANIANSVSGFYRDNNANSNFVPQSEHSRTQESQFAQNMPRMLNQRESEENTLRME
DLERMNGTARRPMAGADQTQYSDWDNQSRQSGRSNQSQFKSKNKLRVKGLESIYLQRLEP
TVRARQAAPSRKTDDKTKFRVTQTNKFQNEPALFNDGYGEEDDRDELESVISNNYNQMLQ
QEFRGKDGTTKRRKKGKKSRQVSQNQMGTINGGGATGTFHNNDSQQDMFNAPNLFTGNFS
QDKDKKFKSQVPSLDFGN