Identifiers and Description

Gene Model Identifier

Contig17466.0.g110

Standard Name

LSF1i

Aliases

Contig17466_0_g110

Description

Concanavalin A-like lectin/glucanases superfamily

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( pfam13385 ) Concanavalin A-like lectin/glucanases superfamily
  • ( pfam01825 ) Latrophilin/CL-1-like GPS domain

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000709101.9991939848149086e-44Neurohypophysial hormones, N-t
erminal Domain ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig17466.0.g110(coding)
ATGCAAACTATGGATTTTATTCATTTTGGCTTAAAGTTCACACCTGCAAATCCTGCTCTT
AGTATACCATAAATCAGAATTTGGCTACTCACTGCAACAGACCCTATACTATCAACTCGC
TCAATGAATTTTGTCTTGAGAGTCGACTCAAATAATCTTATCAGTTTACCTGCATCTGAT
GGGAAATGGAACTTTGTTTATGTTGGATATTCAAAATCGAATACCAACTGGTACATGAAT
GTCAATGATCAGGAACAGTCAGCAACTGTTGCAGCTTGTCCACATTTCCCAAAAATAGAA
TTCTTTAGGTATCTATACACAACTTCCAACAATAAAGATGCAAAAATGCTTGAAATGTAA
TTTTGGAATTTAACAGCTACAGATGTCGTAAATTTAAGTCAGTTTTATGAAAGATATTCT
GGCATTTCTTTCAAGTACTCATAAAATAATCTTAGACCTGCATAACTGGTTGATTACTTA
TCAACATGGAATAGTAATGCTGATTAATGGTATGGAAGAATTGATTACAAAGAATTCTTA
GCAAGTGTAGATGGTAATAGATTCGCATGGAAAGATTAGGGCGCATAAAATCCAGTTTGT
CCTCCAACCTAAAAATATGACTTCAACAACGCTAAATGCATTGCATGTGTCTCCCCATGC
TCAGAGTGCAGCTACTATTCAGAAAGCAAATGTTTGACTTGTATTGCAGGAGGGTACTCA
CTAATTGATAACACGTGTTCCAAGAGTGACTGCCCCAAGGGCTAGTACTACAATAGCACT
CTAAAGATTTGCTTGGCTTGTGTTAGTCCTTGTTCCACCTGCATTTCTTACTCCAAGTGC
AAGTACTGCGTTGCAGGCTATAACTATCATGATAATGGATCTTATAAATGTTTGCCTATC
ACAGATGGATGCGTCAACAGTACTATAGCTGATACCACTGGGCTCCCCATCTGCAGGAAG
TGCCCTCTTGAATGTTCTGTATGCGGTACTGATGGGCTATGTATCCAATGTATTGCTGGA
TATTCACTTTTTAATGGAAAATGTTTCACAGACGGGTGCCCACCTTCCTCATTTTTCAAT
TCATCAACTAGTTTGTGCGAGGCATGTCCTACAGGTTGTTCTCATTGCAAGATAAATGGA
GACTGTACAAAGTGCTAAAGTACTTACTACCTGAATGTGGCAACAAATAAATGTGCTACA
ACATGCCCTTCAAACTTCTACCCCAGTGCTGAATCAAATGCTTGCATGAAATGCTAGCCA
GATTGCGTGAATTGCGTAGGCAATAACTATACATGCACAAAATGTAACTCAAATACATTC
CTGCTTCAAAATTCATGTGTAAAGCAATGTCCTCTTGTTGGATATTTTCATAATACCACT
GCACGAGAATGCTAACCATGTGATTCTGCTTGCGAAGTTTGCATTGCTGATTCCAAAGAT
TGCATTACTTGTTAACCCAATAAATATCTCCACAACAGACAATGCGTCAGTACATGCCCA
GCATCATATTTTGCAGAAAGTTCAAACAATATTTGTTATCCGTGTCATTCGTCTTGTACT
GCTTGTACTAGTGGCTTGCATACAGATTGTTCGGCTTGTGCTGCTGGAAATTATCTACTT
CAAACGACTTGTCTAACTTCCTGTCCTTCTCCATATTATCAAGATTTGACAGCCAAAACA
TGTGACACTTGCAAGTACTTCTGTGATGCATGCACAAATAAGTATAATTGTAACTAATGT
AAACAAGGTTTCGAGCAAGTGCCTGGTAACTGCACGGGTGAATACTTTTTAAGAACTAAA
ATCAATTAAAGACTTTAACTTCCAATAAATACTGCTCAAATGCCAGCAAGTATTGATATG
ATTAAGATGAGCATGGAAATTTGGTTCAAGATTGATGATATTTCAAGCTCAACTCTCTAA
GTCATTGTTGGAGCAACTCCTTACAAATTAAGAAAGAAAGCTAATTCCAAGTCTTTTCAT
TTATCTTTCTAAGGCTTATTGACTTACTGTGAAATAACAAATACTACTTTTGCTTCAGAT
ACTTGGTATCATTATGCATTTACTATAAATGAAGCTAAAGTGTAGCTCAAATGCTACTTT
AATGGGGACCCTATATCGATTGGAGATAGTCCAGCTGTACTTATTGCTTAAGAGTTATAC
AGACCTACTGAGCTTACTCTTGGAGGCACTACAGACCCTAAAGCTTCCGAGATAAACTTT
GTTGGCTACTTAAAAGAATTCAGATTATGGAATATAATAAGAAGTGACTTTGACATTAAG
AATGGAAGATACTATGATATGACATCTAAAGCCTCATTATTTTTCGCATACTGGAAATTA
AATGAAGTAAACGATGGATAGGTTACAAGGTTTATTGATTATTCTTAAGGAGGAACTTCA
AACTTTAACCCATCGACAATTGTTGCTACATAAACAGTTTAAAATTCTATGGAATTCAGA
GAAGCATTCCTTAAAATCTGTAAGGAAGGATGGTATGCTTACAATGATACTATTCTTGGA
TATTAAAAATGTAAACCTTGCGACTCAAATTGCAAGAATTGTATTGGACCATCTGCTACT
GAATGTGTCGAGTGCAATGAACCTTAAAAGTTGCTGCAAACTGAATATAGGTGTATAATT
GTCGAATCTTGCCCAATAAGTTATTTTCAAGATCCAGAAAGTGGTTTATGCGTGAATTGT
AACTCCACATGCAGAATATGCTAAGGAGCACCAAATTTCTGTACATAATGCAACGCCGGG
TATTATAGAGAGTACTAAGGCACAGGCTGTGTCAAAGATTGTCCTGCTGGAATGTATGGA
AACATCGAGAAATAGAGTTGCTTATTCAATCCAATAATAGACTATATCTCCCCTAAAAAT
GGAGCAGTCTTCCTTGCTGGTACTTTCATTGATCTTCATTCAAATTTCACAATGCTTAAT
AATGAGATAAATACCACATATGAATATGGTTGGAAAATTGTAAGACAAGATGGAAACGTT
GATATAACAAACGATGCTTTCAAAACATACTATCAAACTGATATTAGGAAAGTTCATTTA
GATAATAACATAGTCTAAGCCAATAACTACTACATAATTAGTTTTTATGTCAGAGGACTT
GATCAATTTTATAAGGGAATGTATTCTGAGATGAAGACTACAATATATTTGGGAACTCCT
CCAAAAAATGGAAAATGTTAAATATCCCCAATAATTGGAATTGCTACAATTACTAAATTT
TAAATATAGCAAACCAATTGGATTGACCTCGAGCCAATAGATGCCTACGATTTCTTTTAT
TCTATGGACGGAGGAGAAGTATTTTTGCCTCTTGAAAGTACTGAAATTACACTAACATCC
TTAAATTATACTTTTGCAGCAACTTATAATTAATACACAGATGTGAAGATAAAATGTAAA
GCGACAAATGTTAAAGGTTTCTATAATCAAATCATAACAACAATCACTCTTGAAAAGAAA
TCTAGTTCTGATGCATCATATGATTTAGAAAAGCTTAACCCAGCTCTTGCATAGAGTGAG
GTTGAGGTCCTTCTTCAGATACAATAGCTAAAATTGGTCACTTAATACCTTGGCAACTTG
CAATATCAAGATAGCACAAGGTTCGACCCAAAATTAGAATCCTATCAGTGCACCTCAAAA
CTTTGCAATAATTAAGGAAATTGCTCATACATACCATACACTAAGAAATATTACTGTTAG
TGTGAAACTAAAATTGGTGGCTAAAACTGTACTTTTATTAATAATACGCAAATTCAAGTG
ATAAAAACTAAAATATAATAATTAGCAGCTTCTTACGAATCACTCTCAGACAAGGTTTAT
GAATTCGAATTTATGAAATTAATTACAGCTTACAAAGAGCAATTAAATGATGTTACGTTT
GGAATTGTTATTTCTGTAATATACTATAAAATTCATCAATGGGATGGTTCAAGTTAAGAT
GAAAACAGCTTAAACAGTTATTTGCAAATTACCTCAAATCTATTGGAGTACATAGAATAT
GATATTATAGAAAATAATGTAACAAAAAGTTGGAGTAGCATTATTGGCAAGTCTTAAACT
GTCTATGATAATATGCAGCTTGCTATATAAATATTTGAGGCAGTAAGATAAAACTCACTT
GCTTAAGTAAATATGGTTGACACCTAGAAATAATTCATTTCGCGAATGATTGCTTTTAAA
CAAGTTCTACTATCATAAGATGCTCTAATCTCAGTTTCTGCAACTGATTTCTCTCGTAGA
AAAGATAGAACAATAGTTAAAGTTACCCCAAATATATTCTAAACTGCTGTAGTGCCATTA
GAGTCGCAGTATATTTTAGAAGTAGTTGAGTATGCTATAAATCCACTCTAAGTAGTAAAC
CTGAACAATATAGCCAGTAATGTCTTCTCCACTACTTTCTACAATTCTTCAACTTATGAG
AAAGCTATTATTAAAAATTTGATGTCAGAAATAGAATTTTATTATCCACACACAGATAAT
TAAAATGTATCAGACTTCATGACCATTTATAATTCACTCAGTCCATATAAAGCTGCTTAA
AACCTCAAAAGGCAAAAAATGATGAATAACAGCAATATGGCTTGTTCTTACTGGGATGAA
ACTACAAATAATTGGAAAAATGATGGTTGCACATTCATAGGAGTAGACAATACTCACATA
AAATGCTCGTGCAATCATCTAACAGTTGTAGCACCCTCGTTTATCACTCCCTCTGATTCA
GGTACAGCTTCTGAAGAGAATATTTAGAACAAGTATGTTTAGGCAGGTAAAAATGATGAG
GGTAAAATAACGAAGGAAGACTTACAAGTTCCACTTGATAGATACTTTAAAAACTTATAG
GAGTTATTGCAACATAAGCAGCCTTAACCTACAGATTTCCTTTTAAACCCAGGATCCTAT
GTCCCACTTATCTTCTGGTTCATGTACATTTCAAGTTTGATATATTACACTGGCAGAGAC
AGAAAAAGAAGGTATAATATGACTAAATCTTAAAATAGAGATGATTTAGCGGAAATCAAA
GATAGAGATGTGCAGTGCTTAGATGAAGTCATTAATGAACTTATTGCTAGAGATTATGCC
AAAAAGAAAGCTGCAGAACTTAAAGGATAAGGATAACAACCTTAAAATAAAACTATAAAG
TTAGAAGCTCCAGAAAAGAAACCTACAAAAAGGAATACTATAAAAGTTCCTGATTCAAAT
TTTCTACATGCTAATGAATCTGGGAAACTTCTAGGTGAAAAGAAGTATTCAACATAGATG
TCGCAACAAGATACTTAATAAAATAGTGCTCAAAAGAAACCAGGCAGTGAAAATTTTGGG
TTTAATCCTATTCCTTAAGAAGATACTCATAAGAGTGAAATTGAAGGTTTCAAATCTTAT
GAAGAAATGACTAAGGAAGAAAAGAAATTCTTAAAAAGACGAGCTAGAAAGAAGGTCTTT
GGGAAAGTTGGAACTATGGACGAAAGAGCGAAAAGATTTTATGATAAAGCAGTGAAGGTA
AAAAGTTCAATAGCAGCTCCAGACAACAAAATGAAGTTTTTCTATGAGGCACTTAAGTCT
AGTCTTTGGATGGGTTTGATGTCAAAGACAAGCAAAATAGCTCCAAGACACGTTAGACTA
GCATTAATGTACTTGTACATCTCACTTCATCTGACAATTTCAAGCATAGCTTTCATTATG
GGTTATATCGATATGTTTGCTGAAATGATAGGGGATTCTATGATTTCAATTTTAGGTGCA
GCAATTCTCACTCACATAATTCCTTGGTTTATTTGTGTTCCAGTGGCTCTTATTTTTAGA
ATGCCTCACAGTATTAGAAGGCAAGTTGAGGGCATTAAGACAAAGAAAATTAATAAAGCC
TTCAAAGAGATTGATAAGCAAATGGGATTAAGATATGCTATTGGCTATTTTATTTGCTAT
TTCTTCTATGCAGTCATGACAGTTCTTGTTACATTCTTCAACTATGTTTACCCTAGTGAC
TATTGCATGTCATGGTTCTTTTTGTTGGTGGTTATATACTTTTTGGATTTAATTGCTTTT
ACATTTGGATTTGCAGGCTTTCAACTTACTCTATCTTTGTTGTCTCAGAAATCTCAGATC
TTTTATAGTGCATGGGCATTCTTTGAAAAAATCAGATACATAAAAAACTTAAGAGGTTGA


>Contig17466.0.g110(protein)
MQTMDFIHFGLKFTPANPALSIPQIRIWLLTATDPILSTRSMNFVLRVDSNNLISLPASD
GKWNFVYVGYSKSNTNWYMNVNDQEQSATVAACPHFPKIEFFRYLYTTSNNKDAKMLEMQ
FWNLTATDVVNLSQFYERYSGISFKYSQNNLRPAQLVDYLSTWNSNADQWYGRIDYKEFL
ASVDGNRFAWKDQGAQNPVCPPTQKYDFNNAKCIACVSPCSECSYYSESKCLTCIAGGYS
LIDNTCSKSDCPKGQYYNSTLKICLACVSPCSTCISYSKCKYCVAGYNYHDNGSYKCLPI
TDGCVNSTIADTTGLPICRKCPLECSVCGTDGLCIQCIAGYSLFNGKCFTDGCPPSSFFN
SSTSLCEACPTGCSHCKINGDCTKCQSTYYLNVATNKCATTCPSNFYPSAESNACMKCQP
DCVNCVGNNYTCTKCNSNTFLLQNSCVKQCPLVGYFHNTTARECQPCDSACEVCIADSKD
CITCQPNKYLHNRQCVSTCPASYFAESSNNICYPCHSSCTACTSGLHTDCSACAAGNYLL
QTTCLTSCPSPYYQDLTAKTCDTCKYFCDACTNKYNCNQCKQGFEQVPGNCTGEYFLRTK
INQRLQLPINTAQMPASIDMIKMSMEIWFKIDDISSSTLQVIVGATPYKLRKKANSKSFH
LSFQGLLTYCEITNTTFASDTWYHYAFTINEAKVQLKCYFNGDPISIGDSPAVLIAQELY
RPTELTLGGTTDPKASEINFVGYLKEFRLWNIIRSDFDIKNGRYYDMTSKASLFFAYWKL
NEVNDGQVTRFIDYSQGGTSNFNPSTIVATQTVQNSMEFREAFLKICKEGWYAYNDTILG
YQKCKPCDSNCKNCIGPSATECVECNEPQKLLQTEYRCIIVESCPISYFQDPESGLCVNC
NSTCRICQGAPNFCTQCNAGYYREYQGTGCVKDCPAGMYGNIEKQSCLFNPIIDYISPKN
GAVFLAGTFIDLHSNFTMLNNEINTTYEYGWKIVRQDGNVDITNDAFKTYYQTDIRKVHL
DNNIVQANNYYIISFYVRGLDQFYKGMYSEMKTTIYLGTPPKNGKCQISPIIGIATITKF
QIQQTNWIDLEPIDAYDFFYSMDGGEVFLPLESTEITLTSLNYTFAATYNQYTDVKIKCK
ATNVKGFYNQIITTITLEKKSSSDASYDLEKLNPALAQSEVEVLLQIQQLKLVTQYLGNL
QYQDSTRFDPKLESYQCTSKLCNNQGNCSYIPYTKKYYCQCETKIGGQNCTFINNTQIQV
IKTKIQQLAASYESLSDKVYEFEFMKLITAYKEQLNDVTFGIVISVIYYKIHQWDGSSQD
ENSLNSYLQITSNLLEYIEYDIIENNVTKSWSSIIGKSQTVYDNMQLAIQIFEAVRQNSL
AQVNMVDTQKQFISRMIAFKQVLLSQDALISVSATDFSRRKDRTIVKVTPNIFQTAVVPL
ESQYILEVVEYAINPLQVVNLNNIASNVFSTTFYNSSTYEKAIIKNLMSEIEFYYPHTDN
QNVSDFMTIYNSLSPYKAAQNLKRQKMMNNSNMACSYWDETTNNWKNDGCTFIGVDNTHI
KCSCNHLTVVAPSFITPSDSGTASEENIQNKYVQAGKNDEGKITKEDLQVPLDRYFKNLQ
ELLQHKQPQPTDFLLNPGSYVPLIFWFMYISSLIYYTGRDRKRRYNMTKSQNRDDLAEIK
DRDVQCLDEVINELIARDYAKKKAAELKGQGQQPQNKTIKLEAPEKKPTKRNTIKVPDSN
FLHANESGKLLGEKKYSTQMSQQDTQQNSAQKKPGSENFGFNPIPQEDTHKSEIEGFKSY
EEMTKEEKKFLKRRARKKVFGKVGTMDERAKRFYDKAVKVKSSIAAPDNKMKFFYEALKS
SLWMGLMSKTSKIAPRHVRLALMYLYISLHLTISSIAFIMGYIDMFAEMIGDSMISILGA
AILTHIIPWFICVPVALIFRMPHSIRRQVEGIKTKKINKAFKEIDKQMGLRYAIGYFICY
FFYAVMTVLVTFFNYVYPSDYCMSWFFLLVVIYFLDLIAFTFGFAGFQLTLSLLSQKSQI
FYSAWAFFEKIRYIKNLRG