Identifiers and Description

Gene Model Identifier

Contig20673.0.g95

Standard Name

LSF1h

Aliases

Contig20673_0_g95

Description

Furin-like cysteine rich region

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_000770209.99946582325553e-18Neurohypophysial hormones, N-t
erminal Domain ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig20673.0.g95(coding)
ATGACAACAACCTTTTGCAATAATGGTTGCTCTTTATGCACTGTGGATTAACTAACTTGT
CTGTCATGTAAGAAGCCTTCAGATACTCCACTACTTGAAAATAGTTAATGCCTTAGTGAA
TGCTTACCTGGGTACTTTGAAATGAATGGCTTGTGTTTCAAATGTTCAGATAAATGCTTG
AAGTGCTAGGCATTTGAATAATGCACATAATGCGAATCTTAAACCAAATTGCAGCTATTA
GACGGGATTTGTGTTGATAAAGATCAGGCAGGCAATAATTCAAATACATGTCCAAATGGT
ACTATGCTAAATGTATAAGGTAACTGTGTCAAGAATCAGTGTGAGAAAGAAGATTGCCAA
CTATGCGGAGTTACTAGTTAATTTTGCTATTACTGCTAAGATAACTTAGTATCATTAAAT
GGTCTGTGTGTTAATCAATGTCCGATTGGCTACTTCAAAGATTAACAAAACACTTGCATA
AAATGTAGTAGTACATGCAAAGAATGTGATGTAACCCCTGATAAATGCTTAAGTTGTAGA
AAAGATACTTATAGCAACAGCAAGCTAGATTTATCAACTAATAAATGTGTTTCTGAATGC
TCTGGTCGAAGTGTATATAATCCATAAAACCCAGATTTCTGTGAGGGGTGTGATGCTTCA
TGCTTAACATGTTCACTTTCAAAGAGTAATTGTACCTCATGTTTCTACGACAAAAACAGT
CTCCAAGATTTATTCTACTTTAACAATAAATGTGTTCAATCTTGCCCTATTGGCTACTTT
AATAACTACCAGACACATGAATGTGAAGAGTAAACCTATCACTTTTTAAGTTTCCCACCA
ATGTACCTCGTCTCATCAGTTACTATTAGTGGACTTACTTTAATTGGAAGCAAAATATTA
TCTGGAAGAGCAGACGTGACAAGTGAAATAGGGATATCTTTACTTACCTAGGTTGAATTC
TTAAACCGAGTCTTCTTGTTATTGAATCTTTGGTCATCTACTAAGTCATTCAGCTTTTGT
GTAACTTGCCTTTCTATTGTTGGAAATTCTTTCCTAGCAATCTACTTCGTGACCATCTTT
ATAGAGCCTATCTGTAACTAACTTCCAAATGCTATAAATTCAAAATCCCTAGTTTTCAAA
TCAGTAATAGTCTTGACTTAATTTTCAGGAATAAATACTGCTAGGCTCTTGACATCAGGT
TTCTTTGGAATTGAAGCACTTTCAAGTAAAATAGACGAGATAATTTATTATGTTAAGCAT
TTCGAAACTATTTCAATGTTAAGCACAGGTCTTAATGTATTTCAATTTTTCACTGGAGTT
TCTTGTGTTTTTGATTTTGGCTTTTCTTAAGACTCCATGGGACTAGGAGTAAATGCAATC
ATAATAAATGGAGTGCTTATTGCAATTCAAACTTATAAATATGTGAGCACTATGAAGGTA
ATCAAATCTTATGAAAAAGTTAACTAAATATGA


>Contig20673.0.g95(protein)
MTTTFCNNGCSLCTVDQLTCLSCKKPSDTPLLENSQCLSECLPGYFEMNGLCFKCSDKCL
KCQAFEQCTQCESQTKLQLLDGICVDKDQAGNNSNTCPNGTMLNVQGNCVKNQCEKEDCQ
LCGVTSQFCYYCQDNLVSLNGLCVNQCPIGYFKDQQNTCIKCSSTCKECDVTPDKCLSCR
KDTYSNSKLDLSTNKCVSECSGRSVYNPQNPDFCEGCDASCLTCSLSKSNCTSCFYDKNS
LQDLFYFNNKCVQSCPIGYFNNYQTHECEEQTYHFLSFPPMYLVSSVTISGLTLIGSKIL
SGRADVTSEIGISLLTQVEFLNRVFLLLNLWSSTKSFSFCVTCLSIVGNSFLAIYFVTIF
IEPICNQLPNAINSKSLVFKSVIVLTQFSGINTARLLTSGFFGIEALSSKIDEIIYYVKH
FETISMLSTGLNVFQFFTGVSCVFDFGFSQDSMGLGVNAIIINGVLIAIQTYKYVSTMKV
IKSYEKVNQI