Identifiers and Description

Gene Model Identifier

Contig18862.0.g77

Standard Name

LSF1g

Aliases

Contig18862_0_g77

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_009765106.002524403568988e-55Neurohypophysial hormones, N-t
erminal Domain ...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18862.0.g77(coding)
ATGTCACCTAGAAAATAAACGATGAATATTTTATTGGCATTAGTTGCCTCCACTTTTTAG
CCCCCTGCAGGTCCTCCTATTATCGATTTGGCAAGTATTAATGATACTCTAATCAGACAA
AATCTAGGTTATTACTTGCACCTCCAAAATATGACTGATTATTATGGAATGGTTACGATG
CAAATCGCTTCACTTATGTTGACTGATGATTGCCAAAGAAATCAAACAGGATATTTTGAT
AATAGCACTTAGACTTGCAAAACTTGCTCCTAAAATTGCCAATTTTGCAATTAATCCACT
TGCTTCTAATGTGCTTCAGGGTTTAACTTAATTTCTAATTTTTTGACTGGTGTTTCAACT
TGTTAACCATGTATGTCGAATTGTTCAAGCTGCTACCCAAAAGCTATGAATGATACAGCT
TTGAAATGTCTTGAGTGCTAGAACATGAACCAATTAAACATCCCAACTAATGATACTTGT
GCATTTAATCAGACTTCTTGCATGCATGGGTACTATTACAATAGCACAACTCTAAACTGT
GAAAAATGTATGCAAGGGTGCAGAATGTGCAATAATGATAGCAGCTGTTAACAATGTGAC
TAATTGATGGGATTAGTGTTCAATTAAACTACAATGAAGTGTGAAAATGTTTCTACTCAA
ACACCCCCTTAACAATAGTGCATAGTTGGCATGTATTATGATAATATAAGTAGTTAATGC
ATGAATTGCTCAGCTAATTGCACAAATTGCTTAAACTCAAATACTTGCAATCAATGCCAG
TTTTATAACTACAATTTAGATTAATGTTATTAATGTGGGCCTGGATGCTCAAATTGCAGT
GATTTTGCACATTGTAATGAATGCATGTCTGAACATTTTACTTTGAAAAATGGATATTGC
CTTGATTAATGTGAGAATAAAACTATGTATCCAGACATAAGCATGACTTGGAACAATGTT
ACAAAAACTTGCACTGAATGTCCTTTGAACTGCTAAAACTGTATATATAACATAACTACT
AATTAAACGGAATGCATGCATTGCGTTCCTGGCTATGAAAACCTAATCGATCCAGTAACT
AGTAAAAATTCTTGTAGCCAGATTAATTGCACTCAACCAAGTGTTTTCATGCTTAACTCT
TCAAGTAGTTTATGTGATTATTGTGGTTCGGGTTGCTAAAATTGCTCTGACGAAACAAGT
TGTGATATTTGCAGGGTTAATTTCAAACTTTTTGAATATTCTTGGAATCCATAGACATAA
AAGTCATTATCTTACTGCTCACCTAACTGTCCATTAGGGCATTGTTTTGAGGGCTTTTAC
TTGGAATAAACAAACAGCAGCAGTGAACCAAATAGCGTGTCTCAGCAATGCATGAAATGC
CCTTAGGAAAATTGTAGAAATTGTATGAAAAATCCAATAAGTTCAAATTCAACATCTAAT
GATATTTCATGCTATTATTGCATTGATGGTTTTAAAGTAGACTGGAGTACTTAGTAATGT
GTCCCTGCTCCAAACTGCCCCTCAGGTTTTTATTACGATTAGAGTTAACAAAGATGTTTA
TCTTGCTCGACCTATGGATGTGATAAATGTGGCTAATTCACTAATTGCTCTAAATGCTTA
ACTGGATTTTCATTAAATGATAACAAAACTTGCTCAAATCTATGCACTTCTGTCGGGCAA
TACTTCAACCAAACTACTAATAAATGTGAAGCTTGCAGCGATGCAATCGGCTGTCTCCAA
TGCAAAGACAGTCAAAATTGCAGTGTATGTAAGAAGGGCTATGCTCAATATTTCAACCCT
ACTATTAATACCACTTAATGTGTGGAATGCACTAGTAGCTGCTCATTTTGCTACGCATTT
GGATCAGCAAACTTTACAAACACCACCAGTACCACTAGATGCTAACTTTGCGATAATAAC
TTCAAATATAATTACTCGACTGGCTTGTGTGATGCTGTAAAGAATTGTCCTGTTTCAACA
TATTTTGATCAGTATGCACAGTAATGCTTGAGTTGTAGTAATGGTTGTAAAAGTTGCTCA
AGCTTTTAAAAGTGCACTGAATGCCTGACTTCTGACGGCTCTTAAACTCTTATTAATGAC
ACTTGCCTACCAACTTGCGAATACTAAATGGTGTTGCAAAAACAAACATCAAATATACTT
TCCTGGCTCTACTTTGATCCACCAACTAAATCTTGTAAGAATTGCTCAATCTCAAGTTGC
TCTATGTGTCACTTTGACAATATTACAACCTCAGAAAAGTGTCATAGATGCTTGCCCGGG
TATCAACTGTCAGCTGACAATTTAACTTGTACTGCAATCAACTGTGAGCAAACAGGAGTC
TTTAAAAACGGAACAGTTTGTGAATATTGTGCGAAAGGTTGTTTGAATTGCCCAAACAAA
TAGAATTGTGATGTTTGTATGAATGATATGACTAAAGATTTGTGGGGTTAATGCTAACCA
GCTTGCACATAAAATCAGTTTTACAATTATACAACACAAATGTGTCAAGTCTGTGGAGAT
GAAAATTGCAATAGATGCAGTGTATCATCTGGCACTTGTTTGAGCTGTACGAATGGAACC
ATGCTGTATAATAATTCTGAAACAAATACGACTAATTGTATTAACTGTCCAGATAAATGT
GAAAGATGTTAATTATCAAATATGAGTGATGGCAATTCGGTTATGTCATGTGAGAAGTGC
ATGCCAGGTCAAAAATTAGATTCATTAGGTCAGTGTAAGCCTATTGATTACTGTGAAATG
GGAAAATTCTTTGATTGGAATTGCTAAACTTGCTAACATTGTCATTAAGGCTGCAGTGAT
TGTTCAGCACCAAATAATTGTACTTCATGCCATCCTGATTTTATGCTTATCGAGTCAAAT
TATACTAAATAATGTGTACCAAGATGTAAAGAAGTAGGAAAATACTATGATACTGAAGAA
ATGATATGTTAAAACTGTTCTGCGAATTGCATAGCTTGCGATGATACTGAAAACTGTGGA
TAATGCCAGAGAGGATATGCTTTAGCTTATAATAGAACTACAGTATTAAATATGGAATTA
ATGTAATAGATGCAAGATAATTCAACATTGCCAAAAAGCATATTCATTGAAGGAGCTACC
TGCCAAAAATGCCCTGAAAACTGTGGAGACTGTTTCATGAACTAAAACTCTAAAATGACT
TGTTCTGTTTGCATGTTCGGTTACAAATTATAGGAAGGGTTATGCGTTAAGCAGACATGT
CTTGATGGTGCTTTTTTCAATCCAAAATTAGAGAGATGCCAAGAATGCCCAAGAAACTGT
TCTAAATGTTTATCTCCATTTGAATGCACATAATGTTCTGCAAAGATAAACACAGTTTAT
AATGGGACATGTGTGGATAAATGCCAACTTACCAGTATGCAGCTAAATATCTCACACTAT
TATGACAATTAGACAGAAACATGCAAATAATGTGGAGTTTCAAATTGCCAAAAGTGCTCA
AATTCTACTAATTGCAATTAATGCTAAATGGGATATTCATGGAATATGGTAAACAGTACC
ACTTCCTGCCTTATGTGTCCAGACAATTGTAATAAGTGCAGCTATGGTGATAGTATGACA
ACAAAATGTGATATGTGCTAGTTAGGGTTTGAATTAAATCCAAGTGGTGTTTGTGTTCCT
ATTAAATGTAGCAATACTACATATATCCTTCCAAACTCGACTTTATGCGACTACTGTCCA
TAAGGCTGCCTGAATTGCTCTTCAAAATATTCTTGCAACAAGTGTCAACCAGGCTTTATA
TTTGAATACTGGAGCAGTAAATGTGTTTCAAATTGCTCAGTCTCATAATTCTTCAACCAA
GATACTCAAAAATGTGATAATTGTTCAGGAAACTGTACTAATTGTGTCGATAAAACATCA
TGTATCAGTTGTCAGAGAGGCTTCTATCAATTAGCCTCAAAGTACTCCCAAACTCTCAAA
CCTGTATGGGATAAGTTAGGTCAAGTTTGCTTGAATTGTACTAAAGGCTGTGATAACTGT
ACATTGAATTACGATGATTCTTAAGTTCAAACTTTCTTGGGAAATGCCAACTTCACTGGA
TATGATTTACTTCCTACTTGCATGCTTTGTGCACCAGGGTATAACCTTAACTCTACAACA
GGAATATGTGATAAAAGTGAAAGCTGTCCTTAGACCAACATGTATTTCAATGAAACTCAA
GATAGATGCTTGTATTGCGCAAGCGGTTCAATGATGAATTCTACAAACAGCACCACCAAC
AATTCTTCTAATCCTTAATGTGGAAATTTAACTTTCTTCAATACTACAACTTAGTAATGC
CAACCTTGCTCGGTGGGGTGCTAACAATGTTCACAAAACGGAACATGCCTCATTTGTCAA
AAAGGATACAGTATTGGCTTCAAATTAGTACTTACACCTAATAATTAATGGATGAATACT
TCAATTTGTTAGATTGTATAGTAGAACTAATCGACTGGAGGCATAATCTAATGTGCAAAA
CTAAACGAATACTTCAACGTACAAATGCGTAGATGTGTTTAATGTACAGCTGGCTGTATG
TAGTGCAGTGTAGATGGTTCATGTATGAAATGCATGCCTGGCTTGAATTTTATTGAGACT
ACATCAGGTGATAATATTTGTAGAGAAACCTGCCCTTAGGAGTCTGCCTTAGTAAAATAT
TAAGATGGCTCTATTAAATGTGTGAAATGTGAATAAGATTGTGCATTATGCAATTCAACT
CATTGTCTGGAATGCAAAAATGGAACGAAACTTTAAATAGATAGCTCAGGTAAATAGAAA
TGCTTGGCTAACTGCCCTTCTAGAACATACTTTGATAATGGATCAATAAGATGTGAAAAG
TGCTCATCTGATTGTGCAACTTGTAACGGACCTTTATCATAAAACTGCTTATCGTGTCCT
CCTAATAAAATATTGAATGAACAATTATAAACTTGCACTAATGTTTGTCCTACTTAAAAT
CAATTTGTAGACTATAATGATTTAAACAAATGCAAAGACTGTGATGTAAATTAATGCGCC
ACTTGTATCTACAATTCAACATTTTGCTAAACTTGCAACAACGGTTTCATTCTGAATAAA
ACTAATCATTAATGTATAAGTGCTTCAGCATGGATCTGTCCAAATGGTATGTACCTAGAT
AAGAGTACCTTAGAATGTTAAAAGTGTCATTCAACATGCCAGACATGTAGTGGACCAGAG
TCAACAAAATGTTTGAGTTGTCCAATATACGCATTTAGTATGAATACCACTTTATCTGAA
AAGTAATGTATGGGCGTATGTCCAGACGGCATGTTTGGTAACTCAAGTACTGGATTGTGT
CAAAGCTGTTAATCAACTTGCTCTAAATGCGCAAATATAGCAAATTCAATACTTTGCACA
GAGTGCGCATCTCCTCTGGTTTCATACAGAGGCCAATGTTTAGAATCATGTCCTGCCGCT
AATTTCTTAAACTCTACAAAGTGTCAACAATGCTCTGAAAATTGTCAAACTTGTACTGCA
TAAGCCTGTACTTAATGTAAAGAAGGATTCAAATAAATATCTTAAGGCACTTCTACTGGA
GCTCTAAAGCTTCCATTATTCTAAAACTAATGTCTTTCTGCAACTTCTGCTTTATGTCCC
AAAGGAACTTTTTACGATTTAACCCTAAAATAATGCATCACTTGCAATGCAGGATGTGCA
GATTGTAGCAGCTTAGAAACCTGCATTCTGACTTGCAACTCAAGTGCAACTGATTGTATT
GGAAAGGCTGACTATGCACTTGGATGCAAAGAAGGATTTACTTTTATTCCAGAGGTTAAC
AAATGTGTTATTAAATGTGAAGATCTATTCAATTTCACTACTAATTCTATTACTAAAAAT
TGTGATAGATGTCAGGCAGGTTGTTCTAATTGCACAAATCCAACAACGTGTACCTAATGT
GCATCTGGGCTCTATTCTTTCAGACACCCAATGACCAATCAGCTTCATTGTATAAGAGAC
TGTGAGCTACTATCATAAGAAATGCCTACTTTACCAAAACTATTTAACGATAAACAATCA
ATGATGTGTAAACCATGCTCTAATGGCTGCTTAAAATGTTCTTAAGCATATTCATACTAT
AACGTCATACAACCAGCTCCTATTTGCGAAATTTGCAGCCCATTTTCTTTTAAGTAAAGC
GTTTATGACTATAATACTTGGGGAATGATTGATGTGTGCTAGTGTTTGTTCAATTATTAA
GTAGAAGTATCTAAAGTTGGGAAAATGCTAAGAGTTCTAACCTAAGATGTTCAATGGGCT
TCATCACTATTGAACGTTACCCTGCCATGTTCAGCATATTTCTAAGCCTTCAGAAGAGAA
TAAAGTCAATGCTATCCATGGTATATGCCTCAAAATAACTCAATGAATTACTAAAACCAA
TCTTAAGACAATATCATGCTATCTCATTTGATTGAACTAAGAAGTCCAAATCTACTAGAC
ATGCATCTTTGCGAAGTCTAAAGTATAACGAGACAAATATATGTTTCTTAAGTGAACGAC
TATGTACCAGTTTAAGAAACACACATAAAAATGAATAACTTACCTGAAGAAGTTATGTCA
AATTTGCTTAAAAAACAATTAATTTTCAAGCTAAACGAAAACAATTTTGCAAGAAAAAAT
TGTGTAGAGGATTAAAATGGACCTAGCGATAAATATCATCTCAGAATTATAGATGCACTA
TGGATTGGAGATAAAGTATATGACTATTTTGATTCACAGCCAGGGCAAAATTCATCAAAT
GGAAATAACTCTGGTTCTGGTTCTAATGGTAATAACGCTACCAATAATGGCAGCTCAATG
AACCAATCTCTCAGTGTTAATATTTTCCTGAATAATCAAGAACTAAGAATTCAAAAATGT
CAACCAGAAGAATAAAGCACTGTATAAATTCTTTACTCAAAGGGATTTGAAACTGGATAT
AAACAAATTTAATGGAAAATTGACATTATTGAGGAATTAACATAATTAAAATTTATTAAT
GTTTAGGATAATACAACAACTAATAACTCAGAAAGAATGAATGATGATTATTAAATTGTT
GACTTAACAGATATGCAACTTATTATTGAGTCTTTGACACTTAAAAGTATGGGATAACTC
GCTTTAAATCTATAGTCACTTCATGAAGCATTGCCTATGGAAGTACAAGCAGTACATTTA
AATATTTCAATCATAGCAATTAACATGCTGAATTAACAAGTGTAAAAAAGAGTACATGCG
GTTATGATTAATTCTCCAAAAATAGAAGTCATACTCGATCAAATTTAAATAAAAATTGCA
CCTTAATAAACTTATACTGTCGCACCTTGGTGGATTGAGTATGGCTGTAATGGTATTGTG
ACGAAAATAAAGTTGACATAAGAAGTCTTAAAACATCATAATCTTTCAATGTCATGTTCA
GTTATGACTGCATAAAAAAGACCAGTAATTTCTGATTTACTAAATTGCACAATTATGCCA
TGGTAATTGAGTTCAGGACAACAATATATAGTAAACTATAAACTTGCCACTCCTTATAAT
ATGGTTACGGATTCTCAAATTGTGACTGTAGAATAAGTTATTCCTGCTTGTAAAATAGCC
TAAGGCTCTTAGATATTAATTCAACCAGATATTGACAATCGAATTAATGCAATAATTAGA
GAGGACATTAATATAAATACATTCAATCTAAAATGGATATGTTGGTACAGAGATCAAATT
ACTGGCAAAAATGTGGAATGTAACGATGCGAAAAGATTGATGATTCAAAAATAAAGCTTG
AATTTTACTATTCCATCTAGTTATCTTGGGTATTCGGGTATTTATTGGTTTGTTTTATCT
ATAAACGACAAAGTTACTGAGTAACCTTTATCTAATTGCTCTATTTAGGTTCAAACTTCT
CCATCTGTTGATTTTTAGGTTACTAGTTTTAAAATCATAGGAGATATAAATGAGAAAAAT
ACTCTAGATCTATCAAAGAAATCGTATGTTTTTACTTGTGAAGCAAATTAGAACCTTAGT
AATATTTATCTACAGAAGTTTAATTATTCTTGGAGCTTAATATCCTCTGAATCTGTTTAA
GTAAATTTAACAAACAGCACTATTGCTGTATAAACTGGAAAATATTTGAGACTGTCTTGG
ACAGCTTTTGAAATTAACAAAGAGTACATTATTTCTTGCTTGCCTCGATCAATTGACGAT
AGTAAAGTTTATGTTTTTGGGTCAACAACCTCTAAGTTCAATACATACAGAACAGTTTTA
AGTGACTCAACTTCGTATTTAAATATGGTTGTTTCCCCATTAACTGATGTCTTGGCTTTT
TCAACTAATGTAACAATCAAGGCTTAAACTATCTCTGATTAACTATTCTACTGTGTACTT
GGGTACACTTCAAATAACAATCTGGCTGTTACTATCTTGTCTCAATCAAAGAGTTATGAA
TCTGCAATAAGTACAACACACATAGTTAAGTTACCATCTGGATAAATTTCCATTTCCTTT
GTATGCCAAGATCCATCTGGAAATGTTCTTGCCTAAAATCAAACAATAGAAGTCAATAAA
GTGATTATTGATGAATCTAACTAAGGAGCTCTTAGTGATTTAATGTTCTAAGGTACAAAT
TCAACAGACTCTGGAATTATTTTACAGTCCTTGAAGCTTAAGTAGGATTTAGGAGAAACG
TCAAATACATTGATTAACTCTACTTCTCAAGCAAGTCTACTTAAGAATTCCATATAATAA
TTGATTTTAAGCTAATAAGACACCCCATTAGATTCAAATAGTTTATCCTCTGCTATTGAG
AAGTCAACTAAGATCGAGGTACTTTAAGTTATTACTACGAGTTTGAAAAACAATGTTGAA
CTCTTGAAAGATAAACAACTTCTTGGAATGACAATTTAAGCTTACCTATCAACTGTAGAT
TCTACCATCTCTGGTTAAAACTAAACTAATAATACTGACAATACTAATCAATCGGCTCCT
TTTATTGAAAGAAGATAGAACGGATAGGTTGTAGAAGTTAATCTGATTGACGTAGATGAA
TTCTAAACAGTTGCTAAAATAGCTGGAGATTTACTTAATCAAACTAAGGATGCAGACTTG
ACTCTTGTGGAGAGAAGAGCTCTTGTCAGTGCTTTCATATAGAATCTCGATTAATATAGT
GGTAGCTTGGCACCTAATTAACAATTCAATAACACTTATGGAGATATTTCATATTCTATT
GTTAAAATTGCTCAAAATGATGGTACAGGCTAATCCAATATTGTAAGCTTGGAAATGAAA
TCAAGAGTTAATATCTCTATAAATGCAAGTGAGAGCGTTTTTGCTTCATATGAAAATGTC
ATTTTTAAAGCAGTAGCTTTTGATAGAAGTGCAATGAATGATACTTAAAAACCAGCAACT
GATTCAGATTTCAATAGCACCATGAAATAGATAGTTCACGAGAGACTAGCAAGTGACATC
TTAATAATAACAGTAGACAATTCCCCAGAGACCTTTTCTCAGGACGGAAAATCTTACATG
CTAAATCAAACCTCAGTTTCTGAATCCTCGAACATGACCATGCCAATTCAATTCGATATT
TCAGTAGATTAAATGCTGTCAGGAATGTAAAACTCCTATAAAAGGTACTTCGAATGCCGT
ACTTTTAATGAAGCTTAACAAGTTTGGGAAGCACTAACATGCTCTGAAACTACAGACATC
AAAGATGATTCGACTTCGGATGTCAAAGTAAAGTGTTGTACAAGTCATCTCTCACAGTTC
ACAGTATTTGAAGTCAATGTAGTCTTGGAGGAACTTCATAATAGTACTGCTATGGTAATC
GAATACTCTGACGATATGTTTGTAAGAGTAGCTACTATGGCATTTGATATATTCTTGATT
GTTTTGGGTATTGCTGGATGCATCCTTGATAGATGCCACGTGCTTCACATGTACAGTGTT
ACAGACGGAAGAGAAAACAAATATGAAGATATCCAAAAAGGTGATACTACTCAATAGCAA
ATCTATGGCTTTGACTAGCCAAAGAATGGATTTGGTAACATATCACCAGATAGACAAAAA
GAATTAGAAGAGTATGAACGTTAGTATCACTAAAACCTTAAGAATTAACTAGCGATTCCC
GCTCCTAATGCAAATGCTTCATTCGACAATAGCATGTTAAATCAGACAAATTACCCTATG
CTGTAGAACAATGTCATCAATCCCATTCCAATCATAGCAAATTTACCAACTATTCAATTG
CAACAGCAATAATAACAGCAATTGTCTGGGAGACCCATGGATGCTAGAGTGAGACCCCCA
TATTCCGGTCATAAAATTTCTGAGTAAAATGCAAGTGATAGTGATGAGGAAGACGGACAA
AATTAGCAAAGATATGAAGGTGGATCATCAGAGGAAGATAACGAATCATAGAATGTGTAG
CATTAGGCCAAAGAAATGTCCAGAAAGAGAAAGGAAAAGAAATCAAAGAAGTCAAACAAT
AAAAAGACCTAATAGTAACTACCAGCTATAAATAACAATAGCACAAACACCCGACTATTC
CAAAAAGTGGACAGAAACACAAACGGATTGCTACCAGACCTCGCCACAGCACAACCCAAT
GACAAGAAGTCAAGCAATCAACTTCAAACCAATGAGAAGAAGAAGCAGAAGAAGACTTCA
CAGGAGTTAGCTGAACAGCAGATGCAAGACGGGAAAGGTGTAGCTAGTGTTAGTTCCAGC
TAGGAGAAAAAGAAAGCCAAGAAGAAAACTAAGGATATCAGTAAGTCTGATGATGACGAT
AGCAATCAATCAAGCAACGATCACGATCATGTAAGAACCAAGGGTGGAGACGCATTTGAT
GACACTAATAGAGGCGGCAAGCCAGCAAATTTAAAGGCAAATGTACTCGCCAATGGTAAA
TTGGTTCTCCCAAGCTAAGGCATATTGCAACCAGATGACAGTGACAACAATCAGTCCTCC
AGAAACAAAGAGGAGGAAGACGATGAGAGACCAGAAGATCACTCAGCAGCTAGAGTTCTT
GGAGGCTATTCCAATAATCAGGGTCCATAGGATCAAAGACAAGTAGTCAACAAAGGAGTA
CCTTAAAATAATACCACAAGTTAGTCACTAACAAACGGAGAGATTTTCTGTAGAGCTATT
AAGTGCTACCACAGAGTAGTTGGTGTTATCTTCAAAGAATCCCCATTCTTGGTAAGATTC
CTGAAAGTGCTCTCTGCAGCCACTCAATTCCACTTAATTCTAATGATAACTGGCCTCTTA
ACAATGATGGGAGAAATGGCTCCAGGCGGTTCACTCATTATCACCATAATTCTTATGAGA
TTCATTCAGATTTTATGTAATATCGCCCCTCAAAAGGCAGACGCTACCAGTCTTAATAAT
TGCAGAAATATCACTTTTGGAATTGTGATGAGTGTCGTGTTTATTGTCAGTCAGATTATC
AGCATGAGTATGAGCAGAGATAAATACCAATTTGAAATTGACGACTGGAAATCAGCCTTT
ATTGGTACCTTCTTCATTGAAGTACTTGCCTTTGATATTTTGGTGAATCCAGTGATTATT
TTGCTGTCAATGAAGTATTGGTGTTCAAGAGCAAGCTATAGATTCCTGTCACCCGCTCTG
ACTCGCAGAAGAAACATCGATAGTGGCCATATCAAATCTAATTTGAAGCAAAATCAGTAT
GATATGGGAGACGCATATATCATGAATTGA


>Contig18862.0.g77(protein)
MSPRKQTMNILLALVASTFQPPAGPPIIDLASINDTLIRQNLGYYLHLQNMTDYYGMVTM
QIASLMLTDDCQRNQTGYFDNSTQTCKTCSQNCQFCNQSTCFQCASGFNLISNFLTGVST
CQPCMSNCSSCYPKAMNDTALKCLECQNMNQLNIPTNDTCAFNQTSCMHGYYYNSTTLNC
EKCMQGCRMCNNDSSCQQCDQLMGLVFNQTTMKCENVSTQTPPQQQCIVGMYYDNISSQC
MNCSANCTNCLNSNTCNQCQFYNYNLDQCYQCGPGCSNCSDFAHCNECMSEHFTLKNGYC
LDQCENKTMYPDISMTWNNVTKTCTECPLNCQNCIYNITTNQTECMHCVPGYENLIDPVT
SKNSCSQINCTQPSVFMLNSSSSLCDYCGSGCQNCSDETSCDICRVNFKLFEYSWNPQTQ
KSLSYCSPNCPLGHCFEGFYLEQTNSSSEPNSVSQQCMKCPQENCRNCMKNPISSNSTSN
DISCYYCIDGFKVDWSTQQCVPAPNCPSGFYYDQSQQRCLSCSTYGCDKCGQFTNCSKCL
TGFSLNDNKTCSNLCTSVGQYFNQTTNKCEACSDAIGCLQCKDSQNCSVCKKGYAQYFNP
TINTTQCVECTSSCSFCYAFGSANFTNTTSTTRCQLCDNNFKYNYSTGLCDAVKNCPVST
YFDQYAQQCLSCSNGCKSCSSFQKCTECLTSDGSQTLINDTCLPTCEYQMVLQKQTSNIL
SWLYFDPPTKSCKNCSISSCSMCHFDNITTSEKCHRCLPGYQLSADNLTCTAINCEQTGV
FKNGTVCEYCAKGCLNCPNKQNCDVCMNDMTKDLWGQCQPACTQNQFYNYTTQMCQVCGD
ENCNRCSVSSGTCLSCTNGTMLYNNSETNTTNCINCPDKCERCQLSNMSDGNSVMSCEKC
MPGQKLDSLGQCKPIDYCEMGKFFDWNCQTCQHCHQGCSDCSAPNNCTSCHPDFMLIESN
YTKQCVPRCKEVGKYYDTEEMICQNCSANCIACDDTENCGQCQRGYALAYNRTTVLNMEL
MQQMQDNSTLPKSIFIEGATCQKCPENCGDCFMNQNSKMTCSVCMFGYKLQEGLCVKQTC
LDGAFFNPKLERCQECPRNCSKCLSPFECTQCSAKINTVYNGTCVDKCQLTSMQLNISHY
YDNQTETCKQCGVSNCQKCSNSTNCNQCQMGYSWNMVNSTTSCLMCPDNCNKCSYGDSMT
TKCDMCQLGFELNPSGVCVPIKCSNTTYILPNSTLCDYCPQGCLNCSSKYSCNKCQPGFI
FEYWSSKCVSNCSVSQFFNQDTQKCDNCSGNCTNCVDKTSCISCQRGFYQLASKYSQTLK
PVWDKLGQVCLNCTKGCDNCTLNYDDSQVQTFLGNANFTGYDLLPTCMLCAPGYNLNSTT
GICDKSESCPQTNMYFNETQDRCLYCASGSMMNSTNSTTNNSSNPQCGNLTFFNTTTQQC
QPCSVGCQQCSQNGTCLICQKGYSIGFKLVLTPNNQWMNTSICQIVQQNQSTGGIIQCAK
LNEYFNVQMRRCVQCTAGCMQCSVDGSCMKCMPGLNFIETTSGDNICRETCPQESALVKY
QDGSIKCVKCEQDCALCNSTHCLECKNGTKLQIDSSGKQKCLANCPSRTYFDNGSIRCEK
CSSDCATCNGPLSQNCLSCPPNKILNEQLQTCTNVCPTQNQFVDYNDLNKCKDCDVNQCA
TCIYNSTFCQTCNNGFILNKTNHQCISASAWICPNGMYLDKSTLECQKCHSTCQTCSGPE
STKCLSCPIYAFSMNTTLSEKQCMGVCPDGMFGNSSTGLCQSCQSTCSKCANIANSILCT
ECASPLVSYRGQCLESCPAANFLNSTKCQQCSENCQTCTAQACTQCKEGFKQISQGTSTG
ALKLPLFQNQCLSATSALCPKGTFYDLTLKQCITCNAGCADCSSLETCILTCNSSATDCI
GKADYALGCKEGFTFIPEVNKCVIKCEDLFNFTTNSITKNCDRCQAGCSNCTNPTTCTQC
ASGLYSFRHPMTNQLHCIRDCELLSQEMPTLPKLFNDKQSMMCKPCSNGCLKCSQAYSYY
NVIQPAPICEICSPFSFKQSVYDYNTWGMIDVCQCLFNYQVEVSKVGKMLRVLTQDVQWA
SSLLNVTLPCSAYFQAFRREQSQCYPWYMPQNNSMNYQNQSQDNIMLSHLIELRSPNLLD
MHLCEVQSITRQIYVSQVNDYVPVQETHIKMNNLPEEVMSNLLKKQLIFKLNENNFARKN
CVEDQNGPSDKYHLRIIDALWIGDKVYDYFDSQPGQNSSNGNNSGSGSNGNNATNNGSSM
NQSLSVNIFLNNQELRIQKCQPEEQSTVQILYSKGFETGYKQIQWKIDIIEELTQLKFIN
VQDNTTTNNSERMNDDYQIVDLTDMQLIIESLTLKSMGQLALNLQSLHEALPMEVQAVHL
NISIIAINMLNQQVQKRVHAVMINSPKIEVILDQIQIKIAPQQTYTVAPWWIEYGCNGIV
TKIKLTQEVLKHHNLSMSCSVMTAQKRPVISDLLNCTIMPWQLSSGQQYIVNYKLATPYN
MVTDSQIVTVEQVIPACKIAQGSQILIQPDIDNRINAIIREDININTFNLKWICWYRDQI
TGKNVECNDAKRLMIQKQSLNFTIPSSYLGYSGIYWFVLSINDKVTEQPLSNCSIQVQTS
PSVDFQVTSFKIIGDINEKNTLDLSKKSYVFTCEANQNLSNIYLQKFNYSWSLISSESVQ
VNLTNSTIAVQTGKYLRLSWTAFEINKEYIISCLPRSIDDSKVYVFGSTTSKFNTYRTVL
SDSTSYLNMVVSPLTDVLAFSTNVTIKAQTISDQLFYCVLGYTSNNNLAVTILSQSKSYE
SAISTTHIVKLPSGQISISFVCQDPSGNVLAQNQTIEVNKVIIDESNQGALSDLMFQGTN
STDSGIILQSLKLKQDLGETSNTLINSTSQASLLKNSIQQLILSQQDTPLDSNSLSSAIE
KSTKIEVLQVITTSLKNNVELLKDKQLLGMTIQAYLSTVDSTISGQNQTNNTDNTNQSAP
FIERRQNGQVVEVNLIDVDEFQTVAKIAGDLLNQTKDADLTLVERRALVSAFIQNLDQYS
GSLAPNQQFNNTYGDISYSIVKIAQNDGTGQSNIVSLEMKSRVNISINASESVFASYENV
IFKAVAFDRSAMNDTQKPATDSDFNSTMKQIVHERLASDILIITVDNSPETFSQDGKSYM
LNQTSVSESSNMTMPIQFDISVDQMLSGMQNSYKRYFECRTFNEAQQVWEALTCSETTDI
KDDSTSDVKVKCCTSHLSQFTVFEVNVVLEELHNSTAMVIEYSDDMFVRVATMAFDIFLI
VLGIAGCILDRCHVLHMYSVTDGRENKYEDIQKGDTTQQQIYGFDQPKNGFGNISPDRQK
ELEEYERQYHQNLKNQLAIPAPNANASFDNSMLNQTNYPMLQNNVINPIPIIANLPTIQL
QQQQQQQLSGRPMDARVRPPYSGHKISEQNASDSDEEDGQNQQRYEGGSSEEDNESQNVQ
HQAKEMSRKRKEKKSKKSNNKKTQQQLPAINNNSTNTRLFQKVDRNTNGLLPDLATAQPN
DKKSSNQLQTNEKKKQKKTSQELAEQQMQDGKGVASVSSSQEKKKAKKKTKDISKSDDDD
SNQSSNDHDHVRTKGGDAFDDTNRGGKPANLKANVLANGKLVLPSQGILQPDDSDNNQSS
RNKEEEDDERPEDHSAARVLGGYSNNQGPQDQRQVVNKGVPQNNTTSQSLTNGEIFCRAI
KCYHRVVGVIFKESPFLVRFLKVLSAATQFHLILMITGLLTMMGEMAPGGSLIITIILMR
FIQILCNIAPQKADATSLNNCRNITFGIVMSVVFIVSQIISMSMSRDKYQFEIDDWKSAF
IGTFFIEVLAFDILVNPVIILLSMKYWCSRASYRFLSPALTRRRNIDSGHIKSNLKQNQY
DMGDAYIMN