Identifiers and Description

Gene Model Identifier

Contig16021.0.g37

Standard Name

LSF1f

Aliases

Contig16021_0_g37

Description

hypothetical protein

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig16021.0.g37(coding)
ATGTACTATTAATTGAAAATTACTAAATCTTTATTCTTAGTATTGTTGGAATAAATTAGT
GCTCAACCATACAGCTTAGCATCCGTTGGCATTACTTTTGACTCACTGTATACCGGTGAC
ACAGCATCACTTACTTTCATAGTCAGTCCATCAGGATTCTCATATTAATCAGGAGATGAA
ATTCACGTCACATTTAGTAATTCCCCTGGATTACTAGATACTACTGCAATTTGTACACCT
GATGGATCTACAGATTATTCCACAGACTGCACATTTATCTCTAATGCTGAGTTTATCGCA
ACCTTGACTATCACAGGGGCAACTCCTAGCTCAGCTGATTTCGCATTAAGCTATGGGTAT
AAAAATCCAAATTCAGCTTAGGCAATTACTTCAGTGCTAATTGAAGTATACAGAAGTAGC
GTGCTATATGGATCTCAGACAATTACTGATTCAATCTAGTTTATTCCAAGTGTCATGACA
TCTGCTTCACTAATACCCACTTCCTCAGTTGTTGCTGATTCCAATTCTGGCCTAACTGTG
GAATTCACTCCATTAAATTACCTACCTAACAATGGCTTTGTGGTAGTGACATTTCCAGAT
TATGCAAACGCAGATGGAGAACATATATCTACTAGCACACCGACTTGCACAGGTGTGAGT
GGCATGCTTACATCCCTCACTTGTTCATATTCCACTTCAGACAACACTTTAACAATTTCA
AACCCAGTATCTGCCTATTCTAAAGGAAGTCCAATTTCTTTTACAGTTGACTCATTCATT
AACCCTTACAATTCCAAGCCAAAAACAGGCTTTAAAATAGAAACTTTTGACAATGATCTC
AATGCTATTGATTATTATGAAGGCTTGACTGTGACAGCAGCTGATTTTGCTGAGTTCTCT
AGTGTTGTAATAACAAGAGATGATGGTATAAAGACAATTGGAGAAGTTTCGTTAATCCAC
ATAGAATTGAGCACAGGATTTCCTATTGATGCACGTTGCAAATTAAGAATTGATTTTCCC
TCGGATTAACCAGTTACTTCAGATTTAACGCACATTTACGGAGATGGAAGTTTAATTCCC
ACTGCGGGAAGTACAACTTTCACACTGTCTCTTGCTTCTAACTATATTGAGTATACAGGG
ATATGCCTTTCATTCATAGACGCATCTTCAAGCTCAGATATGAAGATATATCTAGATTCC
ATAGTAAATGCTGAAAAAGTTAAAGATACATAATCTTTCCAAATATCTCTCTATGCAATA
GATTCTGGAGTTGCTTACAGAATCGCTTAGATTACAACAGGAGCATCAATTACTAGTTCC
ATGCTAGCAGGAGGTGAAATTGAAACATTCACTGTGACTGCTGCTAACCCTGTAGCTGAT
AAAGACACATTATTTACTTTGAGCATAAAGCCAACAAATTCTCTCCCTTACGCATCTAAA
ATTTTAGTTACTTTCCCTTCAGCAATTGCTCTAAAAACATCTCCATGCATAATAAGTTCT
GTTACGCTTCCAATGAATACCACAAGTGGCTGTGAAGTATTATCAAATGTGCTTATACTA
GAATACCCATTTGGGACAACAGGTAGTTACACTAAAGGTGATGACGCATTTTCTTTCCAA
TTCAATAATGGAGGTACCAATCCTAATTCAGTAGGAGATGTTGGAAGCTTTTTAGTTGAA
ACTTTTGAGATTATATCTGGAGATGATATCCTGATAGATTCAAGTACCTTCACCAATGTT
TATAGCACAACTTCTAAGATTCTTGAGTCTCATGTTTCAGCTATAACATCTTATTAAACA
AGCGCTTAAAATCAGATTTACACAATCTAAATAATACCATCTTTAACTATTGCTTCAGGA
TCTATATTAGAAATCACATTTCCAAAATAGATATAGCTGTCTGATTCAAGAACAGCTGTC
GCCTCAGTCACTGCAACTATAGGAGGTACTACGAATACATTAACTGGCTGCACAACCACC
ACAGTAACCAGCAGAGTTAGAGTAACTTGTGCTAGTGCTTTTTCTTCAGATTATACAAGT
GTTGGTACAGCTTTTGTAATAAAGATAGGCGGCATGTTGAACCCAAGATCAATGGAAGTA
ACAAACTCATTTTAGGTCACCATCAAGACACCTGCAGGTGTTGATTAAGAGTCAATTGAC
ACAGGAATAACTGTTTTAATGACTTCTAATCCTCAGATGGTGTCAGTCAAGATTGAACCT
GTAAGTGAGAAAAATGCTGCTACTACCACTTATGTTGTCACTATTAAATCGAGTATTAAG
CTTGTTACAGGAGATCAGCTATCTTTCACTCTTCCAACTGAGGTTGGAATGACATCTGAT
AGCATAAGCTGTCTACCATCCACAATGACGACCAGTGTCTCATGCAGCAAAATAAATTCA
GACACTGGAGTTAAAGCAATTCTTTCATTGAAAAATGGGTTTTAATACAAGGATACACTA
ATACAATTTAAAGTGTATGGCTTAATCAACCCAATTAGCACTATACCCTCATCTACATTC
ACAGATATTATCTTGAAAGATGTTTACTTGAATTTGCTTGAAACTTATTCATCTAGCGTC
ACTGTATCAACTTCTGAGCCTGCTGAACTTAAAACCATGTCTCTAGCTCAAACCAGCCTT
GTAAAAGGAGCCAAGACAACCTATTTAATGAGTTTTGTAAATAACAATAAAATGGCTGCA
GGTTCCGCCTATTCAGTCAAACTACCCTCAACTATCTGGGTTGCTCATTCAATCAAACTT
TGTATAGTTTAAGTGAACTGGATCTCATACAACCCTACTATGTGTGTTGTAGATTATTCA
AACTAAGAGATATTTATTTCAGGGGGTGTGACTATAGCTATAGATGCTGGACAAGTTATC
AATATTATTTTAGAGCCAATTACTAATCCAACCAATACTCGTGTTCTTGAGAGCATCATT
GTTACAAGCTATACAGATGGCACATTTACCTACATGTATGATGCAAATACAGAGGGCTTA
ATTCCTACGTTTGCTTAATCATTTGCAATGAGTTAAATTTTATCAGCAGTAACCTTAACA
GTACTATTGATCGGATTTTAATTAGGCTTTTGA


>Contig16021.0.g37(protein)
MYYQLKITKSLFLVLLEQISAQPYSLASVGITFDSLYTGDTASLTFIVSPSGFSYQSGDE
IHVTFSNSPGLLDTTAICTPDGSTDYSTDCTFISNAEFIATLTITGATPSSADFALSYGY
KNPNSAQAITSVLIEVYRSSVLYGSQTITDSIQFIPSVMTSASLIPTSSVVADSNSGLTV
EFTPLNYLPNNGFVVVTFPDYANADGEHISTSTPTCTGVSGMLTSLTCSYSTSDNTLTIS
NPVSAYSKGSPISFTVDSFINPYNSKPKTGFKIETFDNDLNAIDYYEGLTVTAADFAEFS
SVVITRDDGIKTIGEVSLIHIELSTGFPIDARCKLRIDFPSDQPVTSDLTHIYGDGSLIP
TAGSTTFTLSLASNYIEYTGICLSFIDASSSSDMKIYLDSIVNAEKVKDTQSFQISLYAI
DSGVAYRIAQITTGASITSSMLAGGEIETFTVTAANPVADKDTLFTLSIKPTNSLPYASK
ILVTFPSAIALKTSPCIISSVTLPMNTTSGCEVLSNVLILEYPFGTTGSYTKGDDAFSFQ
FNNGGTNPNSVGDVGSFLVETFEIISGDDILIDSSTFTNVYSTTSKILESHVSAITSYQT
SAQNQIYTIQIIPSLTIASGSILEITFPKQIQLSDSRTAVASVTATIGGTTNTLTGCTTT
TVTSRVRVTCASAFSSDYTSVGTAFVIKIGGMLNPRSMEVTNSFQVTIKTPAGVDQESID
TGITVLMTSNPQMVSVKIEPVSEKNAATTTYVVTIKSSIKLVTGDQLSFTLPTEVGMTSD
SISCLPSTMTTSVSCSKINSDTGVKAILSLKNGFQYKDTLIQFKVYGLINPISTIPSSTF
TDIILKDVYLNLLETYSSSVTVSTSEPAELKTMSLAQTSLVKGAKTTYLMSFVNNNKMAA
GSAYSVKLPSTIWVAHSIKLCIVQVNWISYNPTMCVVDYSNQEIFISGGVTIAIDAGQVI
NIILEPITNPTNTRVLESIIVTSYTDGTFTYMYDANTEGLIPTFAQSFAMSQILSAVTLT
VLLIGFQLGF