Identifiers and Description

Gene Model Identifier

Contig10432.0.g63

Standard Name

LSF1e

Aliases

Contig10432_0_g63

Description

Phosphate transporter family

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Cellular Component

Molecular Function

  • inorganic phosphate transmembrane transporter activity (IEA) | GO:0005315

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003133902.999758165421992e-18hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig10432.0.g63(coding)
ATGAGATCAGGAGGAGGCAATGGAAACAACAATAAGAATAGTGGTTACAACTTTTATGGT
TCATCACAGCCAACGATGATAGCCCCTCATGCCTACATGCACCACTAAGATGACTCTAGT
TCACTCAACGACTTTGGAGAGAGCAACAACCCAAATTAGAATGAAACCAAAATTATGAGT
ATGGACATCAGCAATATCAATGATCGATCTGCTCAAACTGCTGGCATTAATGATAGTAAG
ATAGCGTAGGACATTCAATTTTCACAAAACTTTCAATAAAACGTGATTAGGCCAAATTAA
AGAATTCAAGGTTTCATAATGGAGGAATAAAAATTGCAATCATAAATCCAGCAAACCACA
TCAAACTAATATGTAATCCCTCTCTCTTCATCTGATGAAGACGACAATAATCATAAATAA
TAATAATCACTAGAAAAACAACAAAACAGCATTAGAAAGTAAAACATATCGGCTCCACCA
ATTCCAAATAGCAATTAAGCAATAAGGTCCAAAATGATTGAAAACCAATAAAACTACTAT
AATAGATAATAGGATGGATAGCAGAATAGTAAAAAATAAAGAAAATTATAAAGTCAGAGG
AAAAACGATAATGAAGAGGAGGATTTGGATGAAGAGGAAGATAATGATGGTGATATTTAT
TAGACTGCTCTTAAAACTGATAACCAAGATAGGTCAGGTAGAAAAACCATTGATTTCAAT
CCATCAAACAATAAGTCTGGATATTCCAACCACAGCATAGTGACTGCCGCCTAAAACACA
GCAGAAGGCAAGAGAAAAAGACAATCAGCGAATAAGAGTGAAGCAGCTGAGAACAACACA
AAAAAGAAATCTAGAAATAAGTTTGATAGTGTAGCTACTCCGGGCAATCCAATGTTTGAT
GAATTTGAATACAAAACTAATAATAATGGGAAGATATCAGGAGCCAAGGGAAATAAGGAT
TAAAGTTATGAACAGGATGAGAGCTATGATGATGAATTCGACCAGTCTTACTCAAATAAA
AAGCTTAGAAACCAAGATTTAAGCACAGTTGGTAATGAGAGGGCAAGCGTTATAGAACAC
AATAGTAGCTAGGTTTATCAGTAATTTGATAAAAATAGTGGAAGTTTACCATCTATAAAC
TTGAAAGACAAGTTTTCTAAAGTGCACCCCTAAGATGGCAGTAATGTTCATTCCAGCTAG
TTGCAAACATCAACCAGGATTTAGAGCAAAAGATAAACATAAGACAAGAAAAATTTAAAA
GCCTATGAAGAAACACCAAATTTACAAGGAAGCTCAAGTATCAGAGTTCATACTAAAGAT
AGTAACAATCACACTTAAGATGAGTTTGACTAAAGAGCTTTACGAAACTCTATGCAATCC
AATCGCTTATCAGATCAACCTCAAAACTTTGACAGTAATGACACAAGGGGAGTGAACAGT
TTAACAACAATGGGAGGAAGTAAAAAGAAAGGTAAGAAGAAAAAGAAGAAGAGTCCTATG
AATATAAAGTCCCATTCATCTTAAGGGGAACTTGATGAATCCTATAAATAGATTGATCCT
GACGGTCCTCAATCAAACGATCCTTTCACCAACTAATTGCCTTTATAAGAAACCTTTTAA
AAATAGTACCTGAACCAAAGCGCGAAAGACGATTAAATGGAGAGTTAAGGCAATATTTTA
CCCTCATAGCTTCAAAATGGCAATCATGATTTCGTAGAAGTTTATAAATCAGATAAGTCT
AGATCGAAAAAGATCCTGTTCTGGCTAAGTATAGCAGGTGCAATGATTTAATCAGTAAAT
ATAGCGAGTAATATAGCTGTATATCTAAGCTCCCCATTTAGTACTGAGATTGTGCTGGGT
ATATATTTTGCATTTTTAATCCTAAGGCCAATTATTATTGGATGCTTCATGGCATACTAT
ACTTTCGTTATAGTGTAGAAGAGCTATAGAGAAGAGGAATAGGACTATAGGTTAAAGATT
TAAAACTTGAACGCTGAAAAAAAGAAAAAGAAAAGGTAAAACTTCTTCTAGTGCAAACAC
ATTGTAGCTTATATTTTAAGTTATCCAGTATTGTAATATACAGGTTTTACTCGCATTATT
AGAACTGAAAAAGTTCTTATGTGGGGTACTTCCCATTACTTTATAGAGCTCTTTACTTAA
ACTATTCCACTTTTACTTATACATATTTATAATCATACCAGTTCTAATTTGCCTTATACT
GAACTAGACAAGTTAATGATCGCCTTTTCAGTTATGAGTATAATAGATGTGGGTTTAGAA
CTATTTATTTAAAGACATTTAATTAAGGAAGGTTAAAAGCAAACTTTAATTGGAAGGTTA
CTTAAGAAAAAGAAAACTGTGTTTAATATCACTGTACTCTCTGCTTTAGTAGGTATGGCA
TTTACAGGCACTTGTATAATAGCTCTGGTATTTGGATTTGGAGTAAGAACTTGCCCTAGA
GGATATTATTTACAATAGAGTTAATGCTTTAAATGCAGTGATGTTTTAGGGCCTACATGT
GATGCATGCAGTTCTCCTTTTAAATGTGATGATTGTAGCTATGGACTTTATCCAGACTAA
TTAACTGCTAAGTGTCTTTCTTGTAAAAACACTACTCTTGGGGATACTTGCTAAGATTGC
TCATCAAATTCATGGTGTACTGAGTGCGGGCCTGGAGAGTAGATTGTAAATGGAAAATGT
ACTTCCTGCTCAAATGGATGCACAGATTGTACTGGCAAATTGTGCTCTTCATGTGTGGCA
GGTTTTACTATGGTAAACGGAGTTTGTAAGAAATGCGAAGACCTGATACCATTTTGTGGT
GAATGCTCGGATGATAAAACTTGCACAAAATGCAACAGTACTGAATTTTCAATTTAATAA
AATGGAACTTGTGCATGCGCAGCTGGAAAGTTTTCATTGTACAATAGTACTACTTAAAAG
TGCGATTGCTTACAAAACAATTTCAAGCTTAATGGAACATGTGGAGACTGTACATCTACA
ATTCCTCGATGTGATGAATGTTCCCCTCCTCTCACTTCAACTGTTGGTGTTAAACTAGAT
GATGGTCGTTCCCTTTAATGCTCTAATTGCGGCTACTACAATTTCTTAAGATCAGCAAAT
TATTCTTGCCTCTCTTGCTCAACAAAGTTCCCCAATTGTGGTAGTTGTGGAATGTCTGGA
ACATCGTGTACTAAGTGTCTACCAACTCACTTAAAAACTGGGACAGGTATAAATATTAAG
TGTGAACTTTGCGATGATTATATTAGGAATTGTAAGAAATGTGTTGCTGAAAACTAATGT
ATAGAATGTGTGGATGGCTACCACTTAGGTCTAGGTATCTGTTGGTGGTGGTTCTGGTGA


>Contig10432.0.g63(protein)
MRSGGGNGNNNKNSGYNFYGSSQPTMIAPHAYMHHQDDSSSLNDFGESNNPNQNETKIMS
MDISNINDRSAQTAGINDSKIAQDIQFSQNFQQNVIRPNQRIQGFIMEEQKLQSQIQQTT
SNQYVIPLSSSDEDDNNHKQQQSLEKQQNSIRKQNISAPPIPNSNQAIRSKMIENQQNYY
NRQQDGQQNSKKQRKLQSQRKNDNEEEDLDEEEDNDGDIYQTALKTDNQDRSGRKTIDFN
PSNNKSGYSNHSIVTAAQNTAEGKRKRQSANKSEAAENNTKKKSRNKFDSVATPGNPMFD
EFEYKTNNNGKISGAKGNKDQSYEQDESYDDEFDQSYSNKKLRNQDLSTVGNERASVIEH
NSSQVYQQFDKNSGSLPSINLKDKFSKVHPQDGSNVHSSQLQTSTRIQSKRQTQDKKNLK
AYEETPNLQGSSSIRVHTKDSNNHTQDEFDQRALRNSMQSNRLSDQPQNFDSNDTRGVNS
LTTMGGSKKKGKKKKKKSPMNIKSHSSQGELDESYKQIDPDGPQSNDPFTNQLPLQETFQ
KQYLNQSAKDDQMESQGNILPSQLQNGNHDFVEVYKSDKSRSKKILFWLSIAGAMIQSVN
IASNIAVYLSSPFSTEIVLGIYFAFLILRPIIIGCFMAYYTFVIVQKSYREEEQDYRLKI
QNLNAEKKKKKRQNFFQCKHIVAYILSYPVLQYTGFTRIIRTEKVLMWGTSHYFIELFTQ
TIPLLLIHIYNHTSSNLPYTELDKLMIAFSVMSIIDVGLELFIQRHLIKEGQKQTLIGRL
LKKKKTVFNITVLSALVGMAFTGTCIIALVFGFGVRTCPRGYYLQQSQCFKCSDVLGPTC
DACSSPFKCDDCSYGLYPDQLTAKCLSCKNTTLGDTCQDCSSNSWCTECGPGEQIVNGKC
TSCSNGCTDCTGKLCSSCVAGFTMVNGVCKKCEDLIPFCGECSDDKTCTKCNSTEFSIQQ
NGTCACAAGKFSLYNSTTQKCDCLQNNFKLNGTCGDCTSTIPRCDECSPPLTSTVGVKLD
DGRSLQCSNCGYYNFLRSANYSCLSCSTKFPNCGSCGMSGTSCTKCLPTHLKTGTGINIK
CELCDDYIRNCKKCVAENQCIECVDGYHLGLGICWWWFW