Identifiers and Description

Gene Model Identifier

Contig18667.0.g27

Standard Name

LSF1c

Aliases

Contig18667_0_g27

Description

Domain of unknown function (DUF4382)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( pfam14321 ) Domain of unknown function (DUF4382)

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_003042400.000000000000001999258566166494conserved hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig18667.0.g27(coding)
ATGACATCTAAGCTTTTCACAGAGTAGTAAGGTTTTTTAAGTGAGGTATCTTTTGAACAT
ATACCTTAATCATAAGCTCAAGGTGCAATAACAAAAAGATATCTTGAAGCTTACCCAAAC
TTTGTGAAGTCTATGTACTCTGTTAATGAGACAACTTACTCAGCCGCAAGCTAATTAAGC
ATTGTATTTTATGTACAGTCAAGCTATCCCTTGATTGCTCCAATCACATTGAGCATTTCA
ATCCCATAGGAATTCGATGTCTTACAGGGTAGCTAAACTTGTCAACTATCATATCAAGTT
TTGACATAGAAAACTGAAACCTAACTACAATGTCAAGTCAATTAAGGAACAATTTAGACT
ACACTTTAATAAAACATGATTTTCGATAGCTATTAATAGATCATTCTCACTATTGATAGT
CTTTTTAGGAACCCAAAAATAATTGGTTCAAATTTCCCTGATATAAGTGTGTAGATCTAG
TCTAAATACTCAAATCTAACCCTAACTTCGCAATCATAATAGATTGTCACGTCAATTTAA
GCAACCATATAAGCAACAATGAGAACTACTACTTTTACAGGTAATATGATTAACGACCTG
CTGTTAACAATGACAACTAATGTTGATGTACCAAGCAACAGCTAGACAACTATTTAATTC
CCAAATGATTGGATTGTGACTGAAGCTTTTAGTTTTGGAACTCTAGATTTCAATTCTTCA
TACAAGTCTGCTGGTTTAAAAACTTAACTAATTTTAAAACCAAAATATCCAATTAAAACT
GGAGAAACAATCGCTTTCAACATTAGTGGCATAATTCTTCCACGTCATTAACTTTAAAAA
GGGATTGAACAAATTAAGATTATTTTTTCGTACTCCAATAATACAGAATTTTAACATGGA
TACGCAGATATATCATAAGATGTTTAAAGCAGATTTTTACCAATATCTTAGGCTTACTTC
TAACTATCTTATAACTAACAGCAAACACCATTAATTTTAATTGTAAGTGTTGCTGATTTT
GGCTTGGGATCTGATTCTCTAGAAGTATTTTTTGACGATGCAGTTAGTATTGATACATCA
AAGCTTAAAACATACTAAGAAAATGAAACGGCAATAACTTCTTACTTTATTGAAAATGAT
AGAAAACTAGTAATAAAACTTGATAAAGTTTAAATAGAATAATTGAAGGAATAACGCTTT
AAAATAGTGGGACTCGCTGCTCCGTATAGTACTAAACCAAGCATATACAAGACAAGGCTC
GTAGATTTTTTAAATAGAGAAGTAGGAACTCAGTAAAAGCCTACTTATTTTTAGAATGAT
TATCAAGCTAATTTCACTATCATATTGCTGAGCTCATCTTCAACAGTTGGAACATACACA
AATTTGACATTTACAGTTCCTGATGATGTCTTAATTTACCGTAATGCTACTCTTACAATC
TAGGTTCCATCCTTTCTGTCACCTATTAATGGTACTTTTGAAGTTTACTAAAAGGAAAAA
TAGCTATAAGCTCAGATTCTAAATGGAACTCTTTATCTAAAAGTTTCAAAATTTACTGGA
TTTCCTTTATCAATTAGGAACCTGAAAATAAATAAACCAACCAATAAGTATGAACCTTTC
ATAATGTAGATCTACAATGATGACTCATTAGAGTACAAGATATCCAAGAATCTTAACAGA
ATTATTCTTGGTCTTAACTGTTCATCGTAGTGCTAATCTTGTTATTACGAAGACAATACC
TAATGCCTAAGTTGTTAAGATGGAAAAAATTTATATAACTAATCTTGTATTCCAGAATGC
CCATTAAGATACTTTAGTTTAAAAAACGTCTGCTATAAATGTAGCTCAAATTGTTCTTAA
TGCTCCGAGAAAGCAGATCAATGCTTGGCATGCAATGAATAATTTTTCTTTTACCAGGGT
GAATGCTTAAGCAGTTGCCCAATTAGAACTATAGAAGATCCTATCAATTTGAAATGCTAA
AATTGCCCAAGTCTATGTAAAAAGTGCGATAAATCCCTCGCTTGTTAAGAATGTTAATAA
GGGTCATAACTTAAAAATGGGTATTGCTATGATTGTAGACCTGAAAACGGCTACACCTAT
GATTATGTTAATCAAACATGCATACCGCTCATTTAAGATAGCAACATGGAATATCACGCA
ATCTTTACTCGTGCAGTAGCAGTGGCAATCTTACTGGTAATTTGTACTATAATTCATATA
GGAGTCTCATATAAGCTAGGGGCAAACTTTAGAGACTGCAATTACCTTAAAACATTCATT
TTTAAATCTAACTACCTATCATGCTAAGTAGTCTTGGGTGTCATTCGCATTATATTGCAG
TTATGCATCGTTATTATGGGTGGAGATATAGATAACGCATTGCTTGTACTTTACTATCAG
TGTGCAAGGTTTCATTTAAGGTTAATCTACTTTTACATTGTTAAAGGAACAAATAGCGTA
GGAATTAACATGCTCGCCTTATTTGTAAAAGTGCAGATTGTTGACCTTTATTACTATTAA
GACCTCAGATGTTTTCTAATGGGGAGAAATTCAATCAATGAGAGAGAAACTATCTGGAGC
AAAATTATGCAGGCAGGTTACTTTGTTATCGATGCAGCAATTGTAAATATTGGACACTTT
TTAATTGCACCCGACCCAAAAATCACTGCGTACTATTACTTGTTGACAGTTGATTGTTAT
ATGCTGTTCTTGGGTTGCTTGGGTTTGAAGCCAATTATATTATTAATCACAGGCAATCTT
TTTAAAAAGCAAAACAAGGTCAATTGA


>Contig18667.0.g27(protein)
MTSKLFTEQQGFLSEVSFEHIPQSQAQGAITKRYLEAYPNFVKSMYSVNETTYSAASQLS
IVFYVQSSYPLIAPITLSISIPQEFDVLQGSQTCQLSYQVLTQKTETQLQCQVNQGTIQT
TLQQNMIFDSYQQIILTIDSLFRNPKIIGSNFPDISVQIQSKYSNLTLTSQSQQIVTSIQ
ATIQATMRTTTFTGNMINDLLLTMTTNVDVPSNSQTTIQFPNDWIVTEAFSFGTLDFNSS
YKSAGLKTQLILKPKYPIKTGETIAFNISGIILPRHQLQKGIEQIKIIFSYSNNTEFQHG
YADISQDVQSRFLPISQAYFQLSYNQQQTPLILIVSVADFGLGSDSLEVFFDDAVSIDTS
KLKTYQENETAITSYFIENDRKLVIKLDKVQIEQLKEQRFKIVGLAAPYSTKPSIYKTRL
VDFLNREVGTQQKPTYFQNDYQANFTIILLSSSSTVGTYTNLTFTVPDDVLIYRNATLTI
QVPSFLSPINGTFEVYQKEKQLQAQILNGTLYLKVSKFTGFPLSIRNLKINKPTNKYEPF
IMQIYNDDSLEYKISKNLNRIILGLNCSSQCQSCYYEDNTQCLSCQDGKNLYNQSCIPEC
PLRYFSLKNVCYKCSSNCSQCSEKADQCLACNEQFFFYQGECLSSCPIRTIEDPINLKCQ
NCPSLCKKCDKSLACQECQQGSQLKNGYCYDCRPENGYTYDYVNQTCIPLIQDSNMEYHA
IFTRAVAVAILLVICTIIHIGVSYKLGANFRDCNYLKTFIFKSNYLSCQVVLGVIRIILQ
LCIVIMGGDIDNALLVLYYQCARFHLRLIYFYIVKGTNSVGINMLALFVKVQIVDLYYYQ
DLRCFLMGRNSINERETIWSKIMQAGYFVIDAAIVNIGHFLIAPDPKITAYYYLLTVDCY
MLFLGCLGLKPIILLITGNLFKKQNKVN